Recombinant Human PNPLA6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PNPLA6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1229-1327 of Human NTE partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ESRRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSRDEGGSPEGASPSTASEMEEEKSILRQRRCLPQEPPGSATDA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PNPLA6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PNPLA6 Protein

  • EC 3.1.1.5
  • neuropathy target esterase
  • NTENTEMND
  • patatin-like phospholipase domain containing 6
  • Patatin-like phospholipase domain-containing protein 6
  • SPG39
  • sws

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
H00028954-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PNPLA6 Partial Recombinant Protein (H00010908-Q01) (0)

There are no publications for PNPLA6 Partial Recombinant Protein (H00010908-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNPLA6 Partial Recombinant Protein (H00010908-Q01) (0)

There are no reviews for PNPLA6 Partial Recombinant Protein (H00010908-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PNPLA6 Partial Recombinant Protein (H00010908-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PNPLA6 Products

Bioinformatics Tool for PNPLA6 Partial Recombinant Protein (H00010908-Q01)

Discover related pathways, diseases and genes to PNPLA6 Partial Recombinant Protein (H00010908-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PNPLA6 Partial Recombinant Protein (H00010908-Q01)

View related products by pathway.

Blogs on PNPLA6

There are no specific blogs for PNPLA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PNPLA6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PNPLA6