Recombinant Human PMCA1 Protein

Images

 
SDS-Page: Recombinant Human PMCA1 Protein [H00000490-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PMCA1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-97 of Human PMCA1

Source: Wheat Germ

Amino Acid Sequence: MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKT

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP2B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PMCA1 Protein

  • ATPase, Ca++ transporting, plasma membrane 1
  • EC 3.6.3
  • EC 3.6.3.8
  • Plasma membrane calcium ATPase isoform 1
  • plasma membrane calcium ATPase
  • Plasma membrane calcium pump isoform 1
  • plasma membrane calcium pump
  • plasma membrane calcium-ATPase
  • PMCA1kb
  • PMCA1plasma membrane calcium-transporting ATPase 1

Background

ATP2B1 - ATPase, Ca++ transporting, plasma membrane 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
NB300-569
Species: Hu, Mu, Rt, Po, Am, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87259
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56483
Species: Hu
Applications: ICC/IF
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
AF3320
Species: Hu
Applications: WB, IHC
NBP2-29942
Species: Hu, Rt
Applications: WB, Flow, IHC-P
NBP1-83973
Species: Hu
Applications: IHC, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
H00000489-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-622
Species: Hu, Mu, Rt, Am, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for PMCA1 Partial Recombinant Protein (H00000490-Q01) (0)

There are no publications for PMCA1 Partial Recombinant Protein (H00000490-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMCA1 Partial Recombinant Protein (H00000490-Q01) (0)

There are no reviews for PMCA1 Partial Recombinant Protein (H00000490-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PMCA1 Partial Recombinant Protein (H00000490-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PMCA1 Partial Recombinant Protein (H00000490-Q01)

Discover related pathways, diseases and genes to PMCA1 Partial Recombinant Protein (H00000490-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMCA1 Partial Recombinant Protein (H00000490-Q01)

Discover more about diseases related to PMCA1 Partial Recombinant Protein (H00000490-Q01).
 

Pathways for PMCA1 Partial Recombinant Protein (H00000490-Q01)

View related products by pathway.

PTMs for PMCA1 Partial Recombinant Protein (H00000490-Q01)

Learn more about PTMs related to PMCA1 Partial Recombinant Protein (H00000490-Q01).
 

Research Areas for PMCA1 Partial Recombinant Protein (H00000490-Q01)

Find related products by research area.

Blogs on PMCA1

There are no specific blogs for PMCA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

nNOS Antibody
NB100-858

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PMCA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2B1