PLEKHO2 Antibody (3D9) - Azide and BSA Free

Western Blot: PLEKHO2 Antibody (3D9) [H00080301-M03] - Analysis of pp9099 expression in Jurkat (Cat # L017V1).

Sandwich ELISA: PLEKHO2 Antibody (3D9) [H00080301-M03] - Detection limit for recombinant GST tagged pp9099 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3D9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PLEKHO2 Antibody (3D9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PLEKHO2 Antibody (3D9) - Azide and BSA Free (H00080301-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: pp9099 (NP_079477, 392 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GDLLGEGPRHPLQPRERLYRAQLEVKVASEQTEKLLNKVLGSEPAPVSAETLLSQAVEQLRQATQVLQEMRDLGELSQEAPGLREKRKELVTLYRRSAP
• Specificity: pp9099 - PH domain-containing protein
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PLEKHO2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLEKHO2 Antibody (3D9) - Azide and BSA Free

• DKFZp761K2312
• FLJ38884
• PH domain-containing family O member 2
• PH domain-containing family Q member 1
• PH domain-containing protein
• pleckstrin homology domain containing, family O member 2
• pleckstrin homology domain containing, family Q member 1
• pleckstrin homology domain-containing family O member 2
• Pleckstrin homology domain-containing family Q member 1
• PLEKHQ1
• PP1628
• pp9099

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLEKHO2
• Entrez:
  • 80301(Human)
• Uniprot:
  • NP_079477(Human)