PLEKHA3 Antibody

Images

 
Western Blot: PLEKHA3 Antibody [NBP2-88066] - WB Suggested Anti-PLEKHA3 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLEKHA3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PLEKHA3. Peptide sequence: DTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Porcine (100%), Bovine (100%), Guinea Pig (93%), Rabbit (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLEKHA3 Antibody

  • FAPP-1
  • FAPP1PH domain-containing family A member 3
  • FLJ20067
  • four-phosphate-adaptor protein 1
  • Phosphatidylinositol-four-phosphate adapter protein 1
  • Phosphoinositol 4-phosphate adapter protein 1
  • pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 3
  • pleckstrin homology domain-containing family A member 3
  • pleckstrin homology domain-containing, family A (phosphoinositide bindingspecific) member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-48615
Species: Hu
Applications: WB, IHC, IHC-P
NB300-834
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-00935
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-12814
Species: Hu
Applications: WB, IP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-04611
Species: Hu
NBP1-88502
Species: Hu
Applications: IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-19020
Species: Hu, Mu, Rt, Po, Bv
Applications: WB
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-88066
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for PLEKHA3 Antibody (NBP2-88066) (0)

There are no publications for PLEKHA3 Antibody (NBP2-88066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHA3 Antibody (NBP2-88066) (0)

There are no reviews for PLEKHA3 Antibody (NBP2-88066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLEKHA3 Antibody (NBP2-88066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PLEKHA3 Products

Bioinformatics Tool for PLEKHA3 Antibody (NBP2-88066)

Discover related pathways, diseases and genes to PLEKHA3 Antibody (NBP2-88066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHA3 Antibody (NBP2-88066)

Discover more about diseases related to PLEKHA3 Antibody (NBP2-88066).
 

Pathways for PLEKHA3 Antibody (NBP2-88066)

View related products by pathway.

PTMs for PLEKHA3 Antibody (NBP2-88066)

Learn more about PTMs related to PLEKHA3 Antibody (NBP2-88066).

Blogs on PLEKHA3

There are no specific blogs for PLEKHA3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHA3