Pleiotrophin/PTN Antibody (2E3.)

Images

 
Western Blot: Pleiotrophin/PTN Antibody (2E3) [H00005764-M02] - Analysis of PTN expression in transfected 293T cell line by PTN monoclonal antibody (M02), clone 2E3.Lane 1: PTN transfected lysate(18.9 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: Pleiotrophin/PTN Antibody (2E3) [H00005764-M02] - Analysis of monoclonal antibody to PTN on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2E3.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pleiotrophin/PTN Antibody (2E3.) Summary

Immunogen
PTN (NP_002816, 45 a.a. - 154 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK
Specificity
pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pleiotrophin/PTN Antibody (2E3.)

  • HARP
  • HBBM
  • HB-GAM
  • HBGF8
  • HBNF
  • HBNF1
  • HBNF-1
  • Heparin-binding brain mitogen
  • HNGF-8
  • NEGF1HBGF-8
  • neurite growth-promoting factor 1
  • neurite growth-promoting factor1)
  • OSF-1
  • Osteoblast-specific factor 1
  • Pleiotrophin
  • PTN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
MAB2688
Species: Hu
Applications: WB
AF4210
Species: Hu
Applications: WB, IHC
AF3697
Species: Hu
Applications: WB
MAB2734
Species: Mu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
232-FA/CF
Species: Hu
AF2200
Species: Hu
Applications: WB, IP

Publications for Pleiotrophin/PTN Antibody (H00005764-M02) (0)

There are no publications for Pleiotrophin/PTN Antibody (H00005764-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pleiotrophin/PTN Antibody (H00005764-M02) (0)

There are no reviews for Pleiotrophin/PTN Antibody (H00005764-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pleiotrophin/PTN Antibody (H00005764-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pleiotrophin/PTN Products

Bioinformatics Tool for Pleiotrophin/PTN Antibody (H00005764-M02)

Discover related pathways, diseases and genes to Pleiotrophin/PTN Antibody (H00005764-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pleiotrophin/PTN Antibody (H00005764-M02)

Discover more about diseases related to Pleiotrophin/PTN Antibody (H00005764-M02).
 

Pathways for Pleiotrophin/PTN Antibody (H00005764-M02)

View related products by pathway.

PTMs for Pleiotrophin/PTN Antibody (H00005764-M02)

Learn more about PTMs related to Pleiotrophin/PTN Antibody (H00005764-M02).
 

Research Areas for Pleiotrophin/PTN Antibody (H00005764-M02)

Find related products by research area.

Blogs on Pleiotrophin/PTN

There are no specific blogs for Pleiotrophin/PTN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pleiotrophin/PTN Antibody (2E3.) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTN
Entrez
OMIM
Uniprot