![Immunocytochemistry/Immunofluorescence: PLD5 Antibody [NBP1-81911] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize2/PLD5 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81911-img0006.jpg "Immunocytochemistry/Immunofluorescence: PLD5 Antibody [NBP1-81911] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DWVGNDFTQNAGTGLVINQADVRNNRSIIKQLKDVFERDWYSPYAKTLQPTKQPNCSSLFKLKPLSNKTATDDTGGKDPRNV |
| Specificity | Specificity of human PLD5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLD5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for PLD5 Antibody (NBP1-81911)Discover more about diseases related to PLD5 Antibody (NBP1-81911).
|
Research Areas for PLD5 Antibody (NBP1-81911)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLD5 |
![Immunohistochemistry-Paraffin: PLD5 Antibody [NBP1-81911] - Staining of human duodenum shows distinct granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/PLD5-Antibody-Immunohistochemistry-Paraffin-NBP1-81911-img0002.jpg "Immunohistochemistry-Paraffin: PLD5 Antibody [NBP1-81911] - Staining of human duodenum shows distinct granular cytoplasmic positivity in glandular cells.")
![Western Blot: Phospholipase A2, group IVA Antibody [NBP2-19809] - Sample (30 ug of whole cell lysate) A: A549 7. 5% SDS PAGE gel, diluted at 1:3000.](http://images.novusbio.com/fullsize2/Phospholipase A2- group IVA Antibody-Western Blot-NBP2-19809-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: Phospholipase A2, group IVA Antibody [NBP2-19809] - Sample: HeLa cells were fixed in iced-cold MeOH for 5 min. Green: PLA2G4A protein stained by PLA2G4A antibody diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/fullsize2/Phospholipase A2- group IVA Antibody-Immunocytochemistry-Immunofluorescence-NBP2-19809-img0003.jpg)
![Immunohistochemistry-Paraffin: Phospholipase A2, group IVA Antibody [NBP2-19809] - Immunohistochemical analysis of paraffin-embedded Lung ca, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/Phospholipase A2- group IVA Antibody-Immunohistochemistry-Paraffin-NBP2-19809-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: TAF1C Antibody [NBP2-58841] - Staining of human cell line HaCaT shows localization to nucleus & nucleoli fibrillar center.](http://images.novusbio.com/fullsize2/TAF1C-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58841-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: F-Actin Antibody (NH3) [NB100-64792] - The distribution of stress fiber was observed by F-actin staining. Image from verified customer review.](http://images.novusbio.com/fullsize2/F-Actin-Antibody-(NH3)-Immunocytochemistry-Immunofluorescence-NB100-64792-img0001.jpg)
![Western Blot: Arylsulfatase D Antibody [NBP1-87486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/Arylsulfatase-D-Antibody-Western-Blot-NBP1-87486-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Arylsulfatase D Antibody [NBP1-87486] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and mitochondria.](http://images.novusbio.com/fullsize2/Arylsulfatase-D-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87486-img0004.jpg)
![Immunohistochemistry-Paraffin: Arylsulfatase D Antibody [NBP1-87486] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Arylsulfatase D Antibody-Immunohistochemistry-Paraffin-NBP1-87486-img0006.jpg)
![Western Blot: ACOT8 Antibody [NBP1-32452] - Rat tissue extracts (50 ug) was separated by 10 % SDS-PAGE, and the membrane was blotted with ACOT8 antibody diluted by 1:1000.](http://images.novusbio.com/fullsize2/ACOT8-Antibody-Western-Blot-NBP1-32452-img0005.jpg)
![Western Blot: ACOT8 Antibody [NBP1-32452] - Sample(30 ug whole cell lysate)A:MOLT4 B:Raji 10% SDS PAGE, antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/ACOT8 Antibody-Western Blot-NBP1-32452-img0002.jpg)
![Western Blot: ACOT8 Antibody [NBP1-32452] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with ACOT8 antibody diluted by 1:1000.](http://images.novusbio.com/fullsize2/ACOT8-Antibody-Western-Blot-NBP1-32452-img0003.jpg)
![Western Blot: POU6F2 Antibody [NBP1-52038] - NBP1-52038 (0.3ug/ml) staining of Mouse Eye lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.](http://images.novusbio.com/fullsize2/POU6F2 Antibody-Western Blot-NBP1-52038-img0002.jpg)
![Western Blot: Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) [NBP2-52559] - Analysis using SERPINA3 mAb against human SERPINA3 (AA: 279-432) recombinant protein. (Expected MW is 42.3 kDa)](http://images.novusbio.com/fullsize2/Serpin-A3-alpha-1-Antichymotrypsin-Antibody-(5G3C11)-Western-Blot-NBP2-52559-img0004.jpg)
![Immunohistochemistry-Paraffin: Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) [NBP2-52559] - Analysis of paraffin-embedded bladder cancer tissues using SERPINA3 mouse mAb with DAB staining.](http://images.novusbio.com/fullsize2/Serpin-A3-alpha-1-Antichymotrypsin-Antibody-(5G3C11)-Immunohistochemistry-Paraffin-NBP2-52559-img0003.jpg)
![Flow Cytometry: Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) [NBP2-52559] - Analysis of A549 cells using SERPINA3 mouse mAb (green) and negative control (red).](http://images.novusbio.com/fullsize2/Serpin-A3-alpha-1-Antichymotrypsin-Antibody-(5G3C11)-Flow-Cytometry-NBP2-52559-img0001.jpg)
![Western Blot: actin, gamma 2 Antibody [H00000072-D01P] - Analysis of ACTG2 expression in transfected 293T cell line by ACTG2 polyclonal antibody.Lane 1: ACTG2 transfected lysate(41.90 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/actin- gamma 2 Antibody-Western Blot-H00000072-D01P-img0002.jpg)
![Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Analysis using SERPINA1 mAb against HEK293 (1) and SERPINA1 (AA: 23-237)-hIgGFc transfected HEK293 (2) cell lysate.](http://images.novusbio.com/fullsize2/Serpin-A1-alpha-1-Antitrypsin-Antibody-(5D1D2)-Western-Blot-NBP2-52557-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Immunofluorescence analysis of GC-7901 cells using SERPINA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.](http://images.novusbio.com/fullsize2/Serpin-A1-alpha-1-Antitrypsin-Antibody-(5D1D2)-Immunofluorescence-NBP2-52557-img0010.jpg)
![Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Analysis of paraffin-embedded bladder cancer tissues using SERPINA1 mouse mAb with DAB staining.](http://images.novusbio.com/fullsize2/Serpin-A1-alpha-1-Antitrypsin-Antibody-(5D1D2)-Immunohistochemistry-Paraffin-NBP2-52557-img0009.jpg)
![Immunohistochemistry: KIAA0564 Antibody [NBP2-30888] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/KIAA0564-Antibody-Immunohistochemistry-NBP2-30888-img0001.jpg)
![Western Blot: FHL5 Antibody [NBP1-32660] - Sample (30 ug of whole cell lysate)A: 293TB: Raji12 % SDS PAGE, antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/FHL5 Antibody-Western Blot-NBP1-32660-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: FHL5 Antibody [NBP1-32660] - Paraformaldehyde-fixed HeLa, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/FHL5 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-32660-img0003.jpg)
![Immunohistochemistry-Paraffin: FHL5 Antibody [NBP1-32660] - Paraffin-embedded SW480 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/FHL5 Antibody-Immunohistochemistry-Paraffin-NBP1-32660-img0004.jpg)
![Western Blot: FAM49B Antibody [NBP1-88582] - Analysis in human cell line A-431.](http://images.novusbio.com/fullsize2/FAM49B-Antibody-Western-Blot-NBP1-88582-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: FAM49B Antibody [NBP1-88582] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.](http://images.novusbio.com/fullsize2/FAM49B Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88582-img0008.jpg)
![Immunohistochemistry-Paraffin: FAM49B Antibody [NBP1-88582] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.](http://images.novusbio.com/fullsize2/FAM49B-Antibody-Immunohistochemistry-Paraffin-NBP1-88582-img0007.jpg)
![Western Blot: ACOT7 Antibody [NBP1-89279] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-16](http://images.novusbio.com/fullsize2/ACOT7-Antibody-Western-Blot-NBP1-89279-img0004.jpg)
![Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human pancreas shows weak to no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize2/ACOT7-Antibody-Immunohistochemistry-Paraffin-NBP1-89279-img0009.jpg)
![Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.](http://images.novusbio.com/fullsize2/ACOT7-Antibody-Immunohistochemistry-Paraffin-NBP1-89279-img0006.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")