PLCL3 Antibody - BSA Free

Western Blot: PLCL3 Antibody [NBP2-88062] - Host: Rabbit. Target Name: PLCH1. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PLCL3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PLCL3 Antibody - BSA Free (NBP2-88062) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLCL3. Peptide sequence: LGATKNRQLQGLKGLFNKNPRHSSSENNSHYVRKRSIGDRILRRTASAPA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLCH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PLCL3 Antibody - BSA Free

• KIAA1069
• phospholipase C, eta 1
• phospholipase C-eta-1
• phospholipase C-eta1a
• phospholipase C-eta1b
• PLC eta 1
• PLC-eta-1
• PLCH1
• PLCL3
• PLC-L3

Background

PLCH1 is a member of the PLC-eta family of the phosphoinositide-specific phospholipase C (PLC) superfamily of enzymes that cleave phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to generate second messengers inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) (Hwang et al., 2005 (PubMed 15702972)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLCH1