PLCH2 Antibody

Immunohistochemistry: PLCH2 Antibody [NBP2-68945] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in secretory cells.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PLCH2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLCH2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  PLCH2 Recombinant Protein Antigen (NBP2-68945PEP)

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for PLCH2 Antibody

• 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase eta-2
• KIAA0450
• phosphoinositide phospholipase C-eta-2
• phosphoinositide phospholipase C-like 4
• phospholipase C, eta 2
• phospholipase C-eta-2
• PLC-eta2
• PLCH2
• PLCL4
• PLC-L4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLCH2