PLAC1 Antibody

Images

 
Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLAC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLAC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLAC1 Protein (NBP2-32379PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLAC1 Antibody

  • cancer/testis antigen 92
  • CT92
  • placenta-specific 1
  • placenta-specific protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-85426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2487
Species: Hu
Applications: WB, IP
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
H00008521-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82785
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16197
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30830
Species: Hu
Applications: IHC, IHC-P
NBP2-13440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81728
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS

Publications for PLAC1 Antibody (NBP2-32379) (0)

There are no publications for PLAC1 Antibody (NBP2-32379).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLAC1 Antibody (NBP2-32379) (0)

There are no reviews for PLAC1 Antibody (NBP2-32379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLAC1 Antibody (NBP2-32379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLAC1 Products

Bioinformatics Tool for PLAC1 Antibody (NBP2-32379)

Discover related pathways, diseases and genes to PLAC1 Antibody (NBP2-32379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLAC1 Antibody (NBP2-32379)

Discover more about diseases related to PLAC1 Antibody (NBP2-32379).
 

Pathways for PLAC1 Antibody (NBP2-32379)

View related products by pathway.

PTMs for PLAC1 Antibody (NBP2-32379)

Learn more about PTMs related to PLAC1 Antibody (NBP2-32379).

Blogs on PLAC1

There are no specific blogs for PLAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLAC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAC1