![Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Analysis in human placenta and prostate tissues. Corresponding PLAC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/PLAC1-Antibody-Immunohistochemistry-Paraffin-NBP2-32379-img0011.jpg "Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Analysis in human placenta and prostate tissues. Corresponding PLAC1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLAC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-NBP2-46376-img0001.jpg)
-Immunohistochemistry-NBP2-46376-img0002.jpg)
-Immunohistochemistry-NBP2-46376-img0003.jpg)
-Immunocytochemistry-Immunofluorescence-H00008521-M05-img0005.jpg)
-Immunohistochemistry-Paraffin-H00008521-M05-img0006.jpg)
-Western-Blot-H00008521-M05-img0008.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for PLAC1 Antibody (NBP2-32379)Discover more about diseases related to PLAC1 Antibody (NBP2-32379).
| Pathways for PLAC1 Antibody (NBP2-32379)View related products by pathway.
|
PTMs for PLAC1 Antibody (NBP2-32379)Learn more about PTMs related to PLAC1 Antibody (NBP2-32379).
| Research Areas for PLAC1 Antibody (NBP2-32379)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLAC1 |
![Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize2/PLAC1-Antibody-Immunohistochemistry-Paraffin-NBP2-32379-img0015.jpg "Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human colon shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize2/PLAC1-Antibody-Immunohistochemistry-Paraffin-NBP2-32379-img0012.jpg "Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human colon shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human placenta shows moderate positivity in secretion.](http://images.novusbio.com/fullsize2/PLAC1-Antibody-Immunohistochemistry-Paraffin-NBP2-32379-img0013.jpg "Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human placenta shows moderate positivity in secretion.")
![Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize2/PLAC1-Antibody-Immunohistochemistry-Paraffin-NBP2-32379-img0014.jpg "Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human prostate shows no positivity in glandular cells as expected.")
![Bioactivity KGF/FGF-7 [Unconjugated]](https://images.novusbio.com/images2/KGF_251KGCF_2861.jpg)
![Bioactivity KGF/FGF-7 [Unconjugated]](https://images.novusbio.com/images/251-kgcf_recombinant-human-kgf-fgf-7-protein-cf-bioactivity-25202391447.jpg)
![Pappalysin-1/PAPP-A [HRP]](https://images.novusbio.com/images2/Pappalysin-1_DPPA00_ELISA_162.jpg)
![Pappalysin-1/PAPP-A [HRP]](https://images.novusbio.com/images2/DATA_Pappalysin1_DPPA00_ELISA_795.jpg)
-Flow-Cytometry-NBP2-02199-img0001.jpg)
-Flow-Cytometry-NBP2-02199-img0002.jpg)
-Western-Blot-NBP2-02199-img0003.jpg)
![IL-27 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IL-27 [Unconjugated]")
-Immunohistochemistry-Paraffin-NBP2-50465-img0003.jpg)
-Flow-(Cell-Surface)-NBP2-50465-img0001.jpg)
-Flow-(Cell-Surface)-NBP2-50465-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")