PLAC1 Antibody

Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Analysis in human placenta and prostate tissues. Corresponding PLAC1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human colon shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human placenta shows moderate positivity in secretion.

Immunohistochemistry-Paraffin: PLAC1 Antibody [NBP2-32379] - Staining of human prostate shows no positivity in glandular cells as expected.

Product Discontinued

PLAC1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLAC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PLAC1 Antibody

• cancer/testis antigen 92
• CT92
• OOSP2B
• OOSP2L
• PLAC1
• placenta-specific 1
• placenta-specific protein 1

Background

PLAC1 may play a role in placental development

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLAC1 Antibody (NBP2-32379)(1)

Publication using NBP2-32379

• Meng X, Liu Z, Zhang L, He Y. Plac1 Remodels the Tumor Immune Evasion Microenvironment and Predicts Therapeutic Response in Head and Neck Squamous Cell Carcinoma Frontiers in Oncology 2022-06-24 [PMID: 35814442] (Immunohistochemistry)

Bioinformatics

• Gene Symbol: PLAC1