PLA2G4A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PLA2G4A Antibody [NBP2-38616] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP2-38616] - Staining of human parathyroid gland shows moderate positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLA2G4A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQ
Specificity
Specificity of human PLA2G4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLA2G4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLA2G4A Protein (NBP2-38616PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLA2G4A Antibody

  • calcium-dependent phospholipid-binding protein
  • cPLA2
  • cPLA2-alpha
  • lysophospholipase
  • MGC126350
  • phosphatidylcholine 2-acylhydrolase
  • Phospholipase A2 group IVA
  • phospholipase A2, group IVA (cytosolic, calcium-dependent)
  • PLA2G4A
  • PLA2G4cytosolic phospholipase A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
H00008398-D01P
Species: Hu, Mu
Applications: WB
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
5255-EN
Species: Hu
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00008399-D01P
Species: Hu, Rt
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC

Publications for PLA2G4A Antibody (NBP2-38616) (0)

There are no publications for PLA2G4A Antibody (NBP2-38616).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2G4A Antibody (NBP2-38616) (0)

There are no reviews for PLA2G4A Antibody (NBP2-38616). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PLA2G4A Antibody (NBP2-38616). (Showing 1 - 1 of 1 FAQ).

  1. Hi. Actually I want to purchase anti cPLA2 antibody raised in rabbit which can bind to both phorphorylated and unphosphorylated mouse cPLA2 group IV. I want to a gel shift assay with western blotting to show that my protein of interest is causing the phosphorylation of cPLA2 inside the mouse macrophages RAW cells.Can you please tell me which antibody would be suitable for the purpose. Thanks a lot.
    • Here are our antibodies raised in rabbit that have been validated to detect cPLA2 in mouse samples in a western blot. We have not specifically confirmed the ability of these antibodies to detect both the phosphorylated and unphosphorylated forms of the protein, and I cannot guarantee that they will clearly differentiate between the two.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PLA2G4A Antibody (NBP2-38616)

Discover related pathways, diseases and genes to PLA2G4A Antibody (NBP2-38616). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2G4A Antibody (NBP2-38616)

Discover more about diseases related to PLA2G4A Antibody (NBP2-38616).
 

Pathways for PLA2G4A Antibody (NBP2-38616)

View related products by pathway.

PTMs for PLA2G4A Antibody (NBP2-38616)

Learn more about PTMs related to PLA2G4A Antibody (NBP2-38616).

Blogs on PLA2G4A

There are no specific blogs for PLA2G4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLA2G4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G4A
Uniprot