PLA2G4A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PLA2G4A Antibody [NBP2-38616] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.

Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP2-38616] - Staining of human parathyroid gland shows moderate positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLA2G4A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PLA2G4A Antibody - BSA Free (NBP2-38616) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLA2G4A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PLA2G4A Protein (NBP2-38616PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PLA2G4A Antibody - BSA Free

• calcium-dependent phospholipid-binding protein
• cPLA2
• cPLA2-alpha
• lysophospholipase
• MGC126350
• phosphatidylcholine 2-acylhydrolase
• Phospholipase A2 group IVA
• phospholipase A2, group IVA (cytosolic, calcium-dependent)
• PLA2G4A
• PLA2G4cytosolic phospholipase A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for PLA2G4A Antibody (NBP2-38616). (Showing 1 - 1 of 1 FAQ).

1. Hi. Actually I want to purchase anti cPLA2 antibody raised in rabbit which can bind to both phorphorylated and unphosphorylated mouse cPLA2 group IV. I want to a gel shift assay with western blotting to show that my protein of interest is causing the phosphorylation of cPLA2 inside the mouse macrophages RAW cells.Can you please tell me which antibody would be suitable for the purpose. Thanks a lot.
   • Here are our antibodies raised in rabbit that have been validated to detect cPLA2 in mouse samples in a western blot. We have not specifically confirmed the ability of these antibodies to detect both the phosphorylated and unphosphorylated forms of the protein, and I cannot guarantee that they will clearly differentiate between the two.

Bioinformatics

• Gene Symbol: PLA2G4A
• Uniprot:
  • P47712(Human)