PKIG Antibody (2D9) - Azide and BSA Free

Western Blot: PKIG Antibody (2D9) [H00011142-M10] - Detection against Immunogen (34.1 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2D9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PKIG Antibody (2D9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PKIG Antibody (2D9) - Azide and BSA Free (H00011142-M10) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PKIG (NP_861521, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS
• Specificity: PKIG - protein kinase (cAMP-dependent, catalytic) inhibitor gamma (2D9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PKIG
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKIG Antibody (2D9) - Azide and BSA Free

• cAMP-dependent protein kinase inhibitor gamma
• MGC126458
• MGC126459
• PKI-gamma
• protein kinase (cAMP-dependent, catalytic) inhibitor gamma

Background

The protein encoded by this gene is a member of the cAMP-dependent protein kinase (PKA) inhibitor family. Studies of a similar protein in mice suggest that this protein acts as a potent competitive PKA inhibitor, and is a predominant form of PKA inhibitors in various tissues. Three alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PKIG
• Entrez:
  • 11142(Human)
• Uniprot:
  • NP_861521(Human)