PKD1L1 Antibody - BSA Free

Western Blot: PKD1L1 Antibody [NBP2-88058] - WB Suggested Anti-PKD1L1 Antibody. Titration: 1.0 ug/ml. Positive Control: NCI-H226 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PKD1L1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PKD1L1 Antibody - BSA Free (NBP2-88058) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PKD1L1. Peptide sequence: MSDGKCGCPWCALNGKAEDRESQSPSSSASRQKNIWKTTSEAALSVVNEK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PKD1L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PKD1L1 Antibody - BSA Free

• PC1-like 1 protein
• polycystic kidney disease 1 like 1
• polycystic kidney disease protein 1-like 1
• polycystin-1L1
• PRO19563

Background

PKD1L1 encodes a member of the polycystin protein family containing 11 transmembrane domains, a receptor for egg jelly (REJ) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. The encoded protein may play a role in the male reproductive system. Alternative splice variants have been described but their biological nature has not been determined; FUNCTION: May have a role in the heart and in the male reproductive system. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PKD1L1