PIP5K2 gamma Antibody (3E10)

Images

 
Sandwich ELISA: PIP5K2 gamma Antibody (3E10) [H00079837-M05] - Detection limit for recombinant GST tagged PIP4K2C is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PIP5K2 gamma Antibody (3E10) Summary

Immunogen
PIP4K2C (NP_079055.2, 310 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDA
Specificity
PIP5K2C - phosphatidylinositol-4-phosphate 5-kinase, type II, gamma (3E10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIP4K2C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
This product is useful for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIP5K2 gamma Antibody (3E10)

  • EC 2.7.1
  • EC 2.7.1.149
  • FLJ22055
  • phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
  • Phosphatidylinositol-5-phosphate 4-kinase type II gamma
  • phosphatidylinositol-5-phosphate 4-kinase type-2 gamma
  • phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
  • PI(5)P 4-kinase type II gamma
  • PIP4KII-gamma
  • PIP5K2C

Background

PIP5K2 also known as Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma, has 3 isoforms, a 421 amino acid isoform that is 47 kDa, a 373 amino-acid isoform that is 42 kDa and a 403 amino-acid isoform that is 45 kDa; mostly found in the cytosol and surrounding plasma membrane; may be important in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum. Disease research is currently being studied with relation to PIP5K2 and rheumatoid arthritis and arthritis. This protein has interactions with BTK, STK11, PIP4K2C, PIK3CG, PIK3R3, PIP5K1A, and over 40 other proteins in D-myo-inositol-5-phosphate metabolism, regulation of actin cytoskeleton, B cell Receptor signaling pathway, D-myo-inositol (1,4,5)-trisphosphate biosynthesis, superpathway of inositol phosphate compounds, inositol phosphate metabolism, and phosphatidylinositol signaling system pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PIP5K2 gamma Antibody (H00079837-M05) (0)

There are no publications for PIP5K2 gamma Antibody (H00079837-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIP5K2 gamma Antibody (H00079837-M05) (0)

There are no reviews for PIP5K2 gamma Antibody (H00079837-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIP5K2 gamma Antibody (H00079837-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIP5K2 gamma Antibody (3E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PIP4K2C
Entrez
Uniprot