PIP5K2 gamma Antibody (3E10) - Azide and BSA Free

Sandwich ELISA: PIP5K2 gamma Antibody (3E10) [H00079837-M05] - Detection limit for recombinant GST tagged PIP4K2C is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 3E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PIP5K2 gamma Antibody (3E10) - Azide and BSA Free Summary

• Immunogen: PIP4K2C (NP_079055.2, 310 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDA
• Specificity: PIP5K2C - phosphatidylinositol-4-phosphate 5-kinase, type II, gamma (3E10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PIP4K2C
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIP5K2 gamma Antibody (3E10) - Azide and BSA Free

• EC 2.7.1
• EC 2.7.1.149
• FLJ22055
• phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
• Phosphatidylinositol-5-phosphate 4-kinase type II gamma
• phosphatidylinositol-5-phosphate 4-kinase type-2 gamma
• phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
• PI(5)P 4-kinase type II gamma
• PIP4KII-gamma
• PIP5K2C

Background

PIP5K2 also known as Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma, has 3 isoforms, a 421 amino acid isoform that is 47 kDa, a 373 amino-acid isoform that is 42 kDa and a 403 amino-acid isoform that is 45 kDa; mostly found in the cytosol and surrounding plasma membrane; may be important in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum. Disease research is currently being studied with relation to PIP5K2 and rheumatoid arthritis and arthritis. This protein has interactions with BTK, STK11, PIP4K2C, PIK3CG, PIK3R3, PIP5K1A, and over 40 other proteins in D-myo-inositol-5-phosphate metabolism, regulation of actin cytoskeleton, B cell Receptor signaling pathway, D-myo-inositol (1,4,5)-trisphosphate biosynthesis, superpathway of inositol phosphate compounds, inositol phosphate metabolism, and phosphatidylinositol signaling system pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIP4K2C
• Entrez:
  • 79837(Human)
• Uniprot:
  • NP_079055(Human)