PILR-beta Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PILR-beta Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PILRB.
  
  

  Source: E. coli

  Amino Acid Sequence: AGHPEIGEAAVAVHQGDQTHHHPGCHNHHHLEAQQHNHHSRPQGHRKQRALRIMAPKSGHCHQGCIGCRCAQNCHFGTAVPPPPVVEEKER

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PILRB
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84701.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PILR-beta Recombinant Protein Antigen

• activating receptor PILRbeta
• Activating receptor PILR-beta
• Cell surface receptor FDFACT
• cell surface receptor FDFACT1
• cell surface receptor FDFACT2
• FDFACT
• FDFACT1
• FDFACT2
• paired immunoglobin-like receptor beta
• paired immunoglobin-like type 2 receptor beta
• paired immunoglobulin-like receptor beta
• paired immunoglobulin-like type 2 receptor beta
• PILRB
• PILRbeta
• PILR-beta

Background

PILRB also known as Paired immunoglobulin-like type 2 receptor beta, has 3 isoforms, a 790 amino acid isoform that is 87 kDa, a 789 amino acid isoform that is 87 kDa, and a 562 amino acid isoform that is 63 kDa; widely involved in the regulation of the immune consists of highly related activating and inhibitory receptors, thought to act as a cellular signaling activating receptor that associates with ITAM-bearing adapter molecules on the cell surface. This protein has been studied for its involvement in Williams-Beuren syndrome and pneumonia. The PILRB protein has also shown an interaction with ABHD16A, PTPN11, PTPN6, SAMSN1, and LYN in the B cell receptor signaling pathway and IL-3 signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PILRB