PILR-beta Antibody

Images

 
Western Blot: PILRB Antibody [NBP1-69382] - This Anti-PILRB antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PILR-beta Antibody Summary

Immunogen
Synthetic peptides corresponding to PILRB(paired immunoglobin-like type 2 receptor beta) The peptide sequence was selected from the middle region of PILRB. Peptide sequence KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PILRB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PILRB and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PILR-beta Antibody

  • activating receptor PILRbeta
  • Activating receptor PILR-beta
  • Cell surface receptor FDFACT
  • cell surface receptor FDFACT1
  • cell surface receptor FDFACT2
  • FDFACT
  • FDFACT1
  • FDFACT2
  • paired immunoglobin-like receptor beta
  • paired immunoglobin-like type 2 receptor beta
  • paired immunoglobulin-like receptor beta
  • paired immunoglobulin-like type 2 receptor beta
  • PILRB
  • PILRbeta
  • PILR-beta

Background

Paired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRB is thought to act as a cellular signaling activating receptor that associates with ITAM-bearing adapter molecules on the cell surface.Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors and their non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. These paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7. This particular gene encodes the non-ITIM-bearing member of the receptor pair, which has a truncated cytoplasmic tail relative to its ITIM-bearing partner and functions in the activating role. Alternative splicing has been observed at this locus and three variants, encoding two distinct isoforms, are described. Additional transcript variants have been identified but their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDX0230P-100
Species: Hu
Applications: WB, Flow, IP
AF3968
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB5240
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-84185
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-59072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-69382
Species: Hu
Applications: WB

Publications for PILR-beta Antibody (NBP1-69382) (0)

There are no publications for PILR-beta Antibody (NBP1-69382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PILR-beta Antibody (NBP1-69382) (0)

There are no reviews for PILR-beta Antibody (NBP1-69382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PILR-beta Antibody (NBP1-69382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PILR-beta Products

Bioinformatics Tool for PILR-beta Antibody (NBP1-69382)

Discover related pathways, diseases and genes to PILR-beta Antibody (NBP1-69382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PILR-beta Antibody (NBP1-69382)

Discover more about diseases related to PILR-beta Antibody (NBP1-69382).
 

Pathways for PILR-beta Antibody (NBP1-69382)

View related products by pathway.

PTMs for PILR-beta Antibody (NBP1-69382)

Learn more about PTMs related to PILR-beta Antibody (NBP1-69382).
 

Research Areas for PILR-beta Antibody (NBP1-69382)

Find related products by research area.

Blogs on PILR-beta

There are no specific blogs for PILR-beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PILR-beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PILRB
Entrez
Uniprot