Novus Biologicals products are now on bio-techne.com

Recombinant Human PIK3R6 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human PIK3R6 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 661-754 of Human PIK3R6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSKAPWLNLHGQQEVEAIKAKPKPLLMPINTFSGIVQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PIK3R6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.08 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIK3R6 GST (N-Term) Protein

  • C17orf38
  • chromosome 17 open reading frame 38
  • FLJ34500
  • HsT41028
  • p84
  • p87 phosphoinositide 3-kinase gamma (PI3Kg) adapter protein
  • p87 PI3K adapter protein
  • p87(PIKAP)
  • p87PIKAPDKFZp666P158
  • Phosphoinositide 3-kinase gamma adapter protein of 87 kDa
  • phosphoinositide 3-kinase regulatory subunit 6
  • phosphoinositide-3-kinase, regulatory subunit 6
  • PI3Kgamma adapter protein of 87 kDa

Background

C17orf38 - chromosome 17 open reading frame 38

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65530
Species: Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF4670
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
NBP2-46413
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NB100-1919
Species: Ca, Fe, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB2890
Species: Hu
Applications: Flow, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
2526-IL
Species: Hu
Applications: BA
NBP2-13440
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-32691
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
H00146850-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for PIK3R6 Partial Recombinant Protein (H00146850-Q01) (0)

There are no publications for PIK3R6 Partial Recombinant Protein (H00146850-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIK3R6 Partial Recombinant Protein (H00146850-Q01) (0)

There are no reviews for PIK3R6 Partial Recombinant Protein (H00146850-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIK3R6 Partial Recombinant Protein (H00146850-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIK3R6 Products

Research Areas for PIK3R6 Partial Recombinant Protein (H00146850-Q01)

Find related products by research area.

Blogs on PIK3R6

There are no specific blogs for PIK3R6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PIK3R6 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R6