Recombinant Human PIGV Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PIGV Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-493 of Human PIGV full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MWPQDPSRKEVLRFAVSCRILTLMLQALFNAIIPDHHAEAFSPPRLAPSGFVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTELLRPLRGLLSLRSCLLISVASLNFLFFMLAAVALHDLGCLVLHCPHQSFYAALLFCLSPANVFLAAGYSEALFALLTFSAMGQLERGRVWTSVLLFAFATGVRSNGLVSVGFLMHSQCQGFFSSLTMLNPLRQLFKLMASLFLSVFTLGLPFALFQYYAYTQFCLPGSARPIPEPLVQLAVDKGYRIAEGNEPPWCFWDVPLIYSYIQDVYWNVGFLKYYELKQVPNFLLAAPVAILVAWATWTYVTTHPWLCLTLGLQRSKNNKTLEKPDLGFLSPQVFVYVVHAAVLLLFGGLCMHVQVLTRFLGSSTPIMYWFPAHLLQDQEPLLRSLKTVPWKPLAEDSPPGQKVPRNPIMGLLYHWKTCSPVTRYILGYFLTYWLLGLLLHCNFLPWT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PIGV
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIGV Protein

  • EC 2.4.1.-
  • FLJ20477
  • GPI mannosyltransferase 2
  • GPI mannosyltransferase II
  • GPI-MT-II
  • phosphatidylinositol glycan anchor biosynthesis, class V
  • phosphatidylinositol glycan, class V
  • Phosphatidylinositol-glycan biosynthesis class V protein
  • PIG-V
  • Ybr004c homolog

Background

Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. The biosynthetic pathway of GPI is mediated by sequential addition of sugars and other components to phosphatidylinositol. PIGV adds the second mannose to the GPI core (Kang et al., 2005 [PubMed 15623507]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13761
Species: Hu
Applications: IHC, IHC-P
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP1-85856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32394
Species: Hu
Applications: IHC, IHC-P
NBP1-31564
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-60017
Species: Hu, Mu
Applications: WB
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00055650-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for PIGV Recombinant Protein (H00055650-P01) (0)

There are no publications for PIGV Recombinant Protein (H00055650-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGV Recombinant Protein (H00055650-P01) (0)

There are no reviews for PIGV Recombinant Protein (H00055650-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGV Recombinant Protein (H00055650-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIGV Products

PIGV H00055650-P01

Bioinformatics Tool for PIGV Recombinant Protein (H00055650-P01)

Discover related pathways, diseases and genes to PIGV Recombinant Protein (H00055650-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGV Recombinant Protein (H00055650-P01)

Discover more about diseases related to PIGV Recombinant Protein (H00055650-P01).
 

Pathways for PIGV Recombinant Protein (H00055650-P01)

View related products by pathway.

PTMs for PIGV Recombinant Protein (H00055650-P01)

Learn more about PTMs related to PIGV Recombinant Protein (H00055650-P01).

Blogs on PIGV

There are no specific blogs for PIGV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PIGV Antibody
NBP1-62449

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PIGV Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGV