Recombinant Human PIGH Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PIGH Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 89 - 188 of Human PIGH partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PIGH
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIGH Protein

  • EC 2.4.1.198
  • GPI-H
  • phosphatidylinositol glycan anchor biosynthesis, class H
  • phosphatidylinositol glycan, class H
  • phosphatidylinositol N-acetylglucosaminyltransferase subunit H
  • Phosphatidylinositol-glycan biosynthesis class H protein
  • phosphatidylinositol-glycan biosynthesis, class H protein
  • PIG-H

Background

PIGH - phosphatidylinositol glycan, class H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86283
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
H00009091-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-38056
Species: Hu
Applications: IHC, IHC-P
NBP1-69261
Species: Hu
Applications: WB, IHC
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-76331
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB6967
Species: Hu
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-85856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow

Publications for PIGH Partial Recombinant Protein (H00005283-Q01) (0)

There are no publications for PIGH Partial Recombinant Protein (H00005283-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGH Partial Recombinant Protein (H00005283-Q01) (0)

There are no reviews for PIGH Partial Recombinant Protein (H00005283-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGH Partial Recombinant Protein (H00005283-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIGH Products

Bioinformatics Tool for PIGH Partial Recombinant Protein (H00005283-Q01)

Discover related pathways, diseases and genes to PIGH Partial Recombinant Protein (H00005283-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGH Partial Recombinant Protein (H00005283-Q01)

Discover more about diseases related to PIGH Partial Recombinant Protein (H00005283-Q01).
 

Pathways for PIGH Partial Recombinant Protein (H00005283-Q01)

View related products by pathway.

Blogs on PIGH

There are no specific blogs for PIGH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
PIGH Antibody
NBP1-83342

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PIGH Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGH