We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PIGC Recombinant Protein Antigen

Images

 
There are currently no images for PIGC Recombinant Protein Antigen (NBP1-86283PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PIGC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIGC.

Source: E. coli

Amino Acid Sequence: YLIRLQLFKENIHGPWDEAEIKEDLSRFLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIGC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86283.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIGC Recombinant Protein Antigen

  • EC 2.4.1.198
  • GPI2class C protein
  • MGC2049
  • phosphatidylinositol glycan anchor biosynthesis, class C
  • phosphatidylinositol glycan, class C

Background

PIGC, also known as Phosphatidylinositol N-acetylglucosaminyltransferase subunit C, is 297 amino acids in length and approximately 34 kDa. PIGC is an important player in GPI anchor biosynthesis because it catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol. Current research on PIGC is being performed relating to several diseases and disorders including malaria and lassa fever. PIGC has also been shown to have interactions with PIGA, DPM2, KLF10, PIGQ and ZHX1 in pathways such as GPI anchor biosynthesis and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13760
Species: Hu
Applications: IHC,  IHC-P
H00009091-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83342
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-84294
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-38056
Species: Hu
Applications: IHC,  IHC-P
NBP1-05034
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-31564
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr,  IHC-P, IP
NBP2-94070
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-86283PEP
Species: Hu
Applications: AC

Publications for PIGC Recombinant Protein Antigen (NBP1-86283PEP) (0)

There are no publications for PIGC Recombinant Protein Antigen (NBP1-86283PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGC Recombinant Protein Antigen (NBP1-86283PEP) (0)

There are no reviews for PIGC Recombinant Protein Antigen (NBP1-86283PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PIGC Recombinant Protein Antigen (NBP1-86283PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIGC Products

Blogs on PIGC

There are no specific blogs for PIGC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PIGC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGC