Recombinant Human Phospholipase C beta 2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Phospholipase C beta 2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 199 of Human PLCB2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVPYKENVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKRVEAALSACHLPKGKPGGAR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PLCB2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Phospholipase C beta 2 Protein

  • EC 3.1.4.11
  • FLJ38135
  • Phosphoinositide phospholipase C-beta-2,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2
  • phospholipase C, beta 2
  • Phospholipase C-beta-2
  • PLC-beta-2

Background

PLCB2( AAH00939, 1 a.a. - 200 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2364
Species: Hu
Applications: WB, IHC
AF4466
Species: Hu, Mu
Applications: WB
AF4716
Species: Hu
Applications: WB
AF5128
Species: Hu, Mu, Rt
Applications: WB
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-20926
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-98867
Species: Rt
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-21399
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB100-91348
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Phospholipase C beta 2 Recombinant Protein (H00005330-P01) (0)

There are no publications for Phospholipase C beta 2 Recombinant Protein (H00005330-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase C beta 2 Recombinant Protein (H00005330-P01) (0)

There are no reviews for Phospholipase C beta 2 Recombinant Protein (H00005330-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phospholipase C beta 2 Recombinant Protein (H00005330-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Phospholipase C beta 2 Products

Bioinformatics Tool for Phospholipase C beta 2 Recombinant Protein (H00005330-P01)

Discover related pathways, diseases and genes to Phospholipase C beta 2 Recombinant Protein (H00005330-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase C beta 2 Recombinant Protein (H00005330-P01)

Discover more about diseases related to Phospholipase C beta 2 Recombinant Protein (H00005330-P01).
 

Pathways for Phospholipase C beta 2 Recombinant Protein (H00005330-P01)

View related products by pathway.

PTMs for Phospholipase C beta 2 Recombinant Protein (H00005330-P01)

Learn more about PTMs related to Phospholipase C beta 2 Recombinant Protein (H00005330-P01).
 

Research Areas for Phospholipase C beta 2 Recombinant Protein (H00005330-P01)

Find related products by research area.

Blogs on Phospholipase C beta 2.

Bitter Taste Receptor Antibodies Used in New Bronchodilator Study
As one of the world's leading antibody suppliers, Novus Biologicals has an expansive GPCR (G-protein coupled receptor) antibody catalog. Novus antibodies to the bitter taste receptor (TAS2R) have recently been used in a study on TAS2R bronchodilator a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Phospholipase C beta 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCB2