Phospholipase A2 XII Antibody

Images

 
Immunohistochemistry: Phospholipase A2 XII Antibody [NBP1-87265] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phospholipase A2 XII Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLA2G12A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Phospholipase A2 XII Protein (NBP1-87265PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Phospholipase A2 XII Antibody

  • EC 3.1.1.4
  • group XII secreted phospholipase A2
  • group XIIA secreted phospholipase A2
  • group XIIA secretory phospholipase A2
  • GXII sPLA2
  • GXII
  • Phosphatidylcholine 2-acylhydrolase 12A
  • phospholipase A2, group XII
  • phospholipase A2, group XIIA
  • PLA2G12
  • ROSSY
  • sPLA2-XII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008399-D01P
Species: Hu, Rt
Applications: WB
NBP2-31685
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
AF4937
Species: Hu
Applications: WB, IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP1-84449
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31558
Species: Hu
Applications: WB, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83367
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-87265
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for Phospholipase A2 XII Antibody (NBP1-87265) (0)

There are no publications for Phospholipase A2 XII Antibody (NBP1-87265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase A2 XII Antibody (NBP1-87265) (0)

There are no reviews for Phospholipase A2 XII Antibody (NBP1-87265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Phospholipase A2 XII Antibody (NBP1-87265). (Showing 1 - 2 of 2 FAQ).

  1. Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies?
    • Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.
  2. Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies recognize other phospholipases?
    • Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.

Secondary Antibodies

 

Isotype Controls

Additional Phospholipase A2 XII Products

Bioinformatics Tool for Phospholipase A2 XII Antibody (NBP1-87265)

Discover related pathways, diseases and genes to Phospholipase A2 XII Antibody (NBP1-87265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase A2 XII Antibody (NBP1-87265)

Discover more about diseases related to Phospholipase A2 XII Antibody (NBP1-87265).
 

Pathways for Phospholipase A2 XII Antibody (NBP1-87265)

View related products by pathway.

Research Areas for Phospholipase A2 XII Antibody (NBP1-87265)

Find related products by research area.

Blogs on Phospholipase A2 XII

There are no specific blogs for Phospholipase A2 XII, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phospholipase A2 XII Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G12A