Phospholipase A2 XII Antibody - BSA Free

Immunohistochemistry: Phospholipase A2 XII Antibody [NBP1-87265] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Phospholipase A2 XII Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHY
• Predicted Species: Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLA2G12A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Phospholipase A2 XII Protein (NBP1-87265PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Phospholipase A2 XII Antibody - BSA Free

• EC 3.1.1.4
• group XII secreted phospholipase A2
• group XIIA secreted phospholipase A2
• group XIIA secretory phospholipase A2
• GXII sPLA2
• GXII
• Phosphatidylcholine 2-acylhydrolase 12A
• phospholipase A2, group XII
• phospholipase A2, group XIIA
• PLA2G12
• ROSSY
• sPLA2-XII

Background

Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s (Gelb et al., 2000 [PubMed 11031251]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Phospholipase A2 XII Antibody (NBP1-87265). (Showing 1 - 2 of 2 FAQ).

1. Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies?
   • Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.
2. Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies recognize other phospholipases?
   • Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.

Bioinformatics

• Gene Symbol: PLA2G12A