PGAP3 Antibody


Western Blot: PGAP3 Antibody [NBP1-69622] - This Anti-PERLD1 antibody was used in Western Blot of THP-1 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PGAP3 Antibody Summary

Synthetic peptides corresponding to PERLD1(per1-like domain containing 1) The peptide sequence was selected from the N terminal of PERLD1. Peptide sequence ECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PERLD1 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PGAP3 Antibody

  • AGLA546
  • CAB2COS16 homolog
  • Gene coamplified with ERBB2 protein
  • MGC9753hCOS16
  • PER1
  • per1-like domain containing 1
  • PERLD1PER1-like domain-containing protein 1
  • post-GPI attachment to proteins 3
  • post-GPI attachment to proteins factor 3
  • PP1498


PERLD1 is involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins. It is required for phospholipase A2 activity that removes an acyl-chain at the sn-2 position of GPI-anchors during the remodeling of GPI.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, ChIP
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for PGAP3 Antibody (NBP1-69622) (0)

There are no publications for PGAP3 Antibody (NBP1-69622).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGAP3 Antibody (NBP1-69622) (0)

There are no reviews for PGAP3 Antibody (NBP1-69622). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGAP3 Antibody (NBP1-69622) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PGAP3 Products

Bioinformatics Tool for PGAP3 Antibody (NBP1-69622)

Discover related pathways, diseases and genes to PGAP3 Antibody (NBP1-69622). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGAP3 Antibody (NBP1-69622)

Discover more about diseases related to PGAP3 Antibody (NBP1-69622).

Pathways for PGAP3 Antibody (NBP1-69622)

View related products by pathway.

PTMs for PGAP3 Antibody (NBP1-69622)

Learn more about PTMs related to PGAP3 Antibody (NBP1-69622).

Blogs on PGAP3

There are no specific blogs for PGAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PGAP3 Antibody and receive a gift card or discount.


Gene Symbol PGAP3