PEX5 Recombinant Protein Antigen

Images

 
There are currently no images for PEX5 Protein (NBP1-87185PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PEX5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEX5.

Source: E. coli

Amino Acid Sequence: DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PEX5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87185.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PEX5 Recombinant Protein Antigen

  • FLJ50634
  • FLJ50721
  • Peroxin-5
  • peroxisomal biogenesis factor 5
  • Peroxisomal C-terminal targeting signal import receptor
  • peroxisomal targeting signal 1 receptor
  • peroxisomal targeting signal import receptor
  • peroxisomal targeting signal receptor 1
  • Peroxisome receptor 1peroxin-5
  • PTS1 receptor
  • PTS1-BP
  • PTS1RFLJ51948
  • PXR1peroxisomal targeting signal 1 (SKL type) receptor

Background

The product of the PEX5 gene binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD). Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57578
Species: Hu
Applications: WB
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-94643
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-32975
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-86321
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-49599
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80955
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-80577
Species: Hu
Applications: ICC/IF, WB
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
8090-ZN
Species: Hu
Applications: EnzAct
NBP3-18137
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB100-2866
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP1-32925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38840
Species: Hu
Applications: IHC,  IHC-P
NBP3-18138
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46202
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB

Publications for PEX5 Protein (NBP1-87185PEP) (0)

There are no publications for PEX5 Protein (NBP1-87185PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX5 Protein (NBP1-87185PEP) (0)

There are no reviews for PEX5 Protein (NBP1-87185PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PEX5 Protein (NBP1-87185PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEX5 Products

Blogs on PEX5

There are no specific blogs for PEX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PEX5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX5