PER3 Antibody (3A7) - Azide and BSA Free

Sandwich ELISA: PER3 Antibody (3A7) [H00008863-M01] - Detection limit for recombinant GST tagged PER3 is 0.3 ng/ml as a capture antibody.

Immunoprecipitation: PER3 Antibody (3A7) [H00008863-M01] - Analysis of PER3 transfected lysate using anti-PER3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PER3 MaxPab rabbit polyclonal antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 3A7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PER3 Antibody (3A7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PER3 (NP_058515.1, 1105 a.a. ~ 1201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDSC
• Specificity: Reacts with period homolog 3 (Drosophila).
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PER3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PER3 Antibody (3A7) - Azide and BSA Free

• Cell growth-inhibiting gene 13 protein
• Circadian clock protein PERIOD 3
• GIG13
• growth-inhibiting protein 13
• hPER3
• period (Drosophila) homolog 3
• period 3
• period circadian protein 3
• period circadian protein homolog 3
• period homolog 3 (Drosophila)

Background

This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PER3
• Entrez:
  • 8863(Human)
• Uniprot:
  • NP_058515(Human)