Peflin Antibody

Images

 
Western Blot: Peflin Antibody [NBP2-56626] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Peflin Antibody [NBP2-56626] - Staining of human cell line PC-3 shows localization to nucleoplasm, cytosol & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Peflin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAA
Specificity
Specificity of human Peflin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Peflin Recombinant Protein Antigen (NBP2-56626PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Peflin Antibody

  • ABP32
  • PEF protein with a long N-terminal hydrophobic domain
  • PEF1A
  • peflin
  • penta-EF hand domain containing 1
  • Penta-EF hand domain-containing protein 1
  • penta-EF-hand domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24479
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90201
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
640-A3
Species: Mu
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-15278
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02342
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77198
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
H00163688-D01P
Species: Hu
Applications: WB, ICC/IF
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-57792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-56626
Species: Hu
Applications: WB, ICC/IF

Publications for Peflin Antibody (NBP2-56626) (0)

There are no publications for Peflin Antibody (NBP2-56626).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peflin Antibody (NBP2-56626) (0)

There are no reviews for Peflin Antibody (NBP2-56626). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Peflin Antibody (NBP2-56626) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Peflin Products

Bioinformatics Tool for Peflin Antibody (NBP2-56626)

Discover related pathways, diseases and genes to Peflin Antibody (NBP2-56626). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peflin Antibody (NBP2-56626)

Discover more about diseases related to Peflin Antibody (NBP2-56626).
 

Pathways for Peflin Antibody (NBP2-56626)

View related products by pathway.

PTMs for Peflin Antibody (NBP2-56626)

Learn more about PTMs related to Peflin Antibody (NBP2-56626).

Blogs on Peflin

There are no specific blogs for Peflin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peflin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEF1