PEAK1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PEAK1 Antibody [NBP1-91052] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PEAK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PEAK1 Antibody - BSA Free (NBP1-91052) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EPNYESPSSNNQDKDSSQASKSSIKVPETHKAVLALRLEEKDGKIAVQTEKEESKASTDVAGQAVTINLVPTEEQAKPYRVVNLEQPLCK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEAK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reactivity from a verified customer review
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot Reactivity from a verified customer review
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PEAK1 Protein (NBP1-91052PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%). Reactivity in mouse kidney epithelial cells reported from verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PEAK1 Antibody - BSA Free

• FLJ21140
• FLJ34483
• KIAA2002
• NKF3 kinase family member
• pseudopodium enriched atypical kinase
• pseudopodium-enriched atypical kinase 1
• SGK269
• sugen kinase 269
• tyrosine-protein kinase SgK269

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PEAK1 Antibody (NBP1-91052)(1)

Publication using NBP1-91052

• Zhang Z, Xie Y, Yi Q et al. PEAK1 maintains tight junctions in intestinal epithelial cells and resists colitis by inhibiting autophagy-mediated ZO-1 degradation Nature Communications 2025-07-24 [PMID: 40707483]

Reviews for PEAK1 Antibody (NBP1-91052) (2)

Average Rating: 3.5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Mouse.

reviewed by: Verified Customer WB Mouse 07/08/2016

Summary

• Application: Western Blot
• Sample Tested: Kidney epithelial cells, whole cell lysates
• Species: Mouse
• Lot: A96140

reviewed by: Rhodora Calizo IF Mouse 06/27/2016

Summary

• Application: Immunofluorescence
• Sample Tested: Mouse kidney epithelial cells
• Species: Mouse
• Lot: A96140

Bioinformatics

• Gene Symbol: PEAK1