Reactivity | Hu, MuSpecies Glossary |
Applications | ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EPNYESPSSNNQDKDSSQASKSSIKVPETHKAVLALRLEEKDGKIAVQTEKEESKASTDVAGQAVTINLVPTEEQAKPYRVVNLEQPLCK |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PEAK1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity per customer review image. |
||
Control Peptide |
|
||
Reviewed Applications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Rhodora Calizo |
WB | Mouse | 07/08/2016 |
Summary
|
||||||||
![]() Enlarge |
reviewed by:
Verified Customer |
IF | Mouse | 06/27/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for PEAK1 Antibody (NBP1-91052)Discover more about diseases related to PEAK1 Antibody (NBP1-91052).
| Pathways for PEAK1 Antibody (NBP1-91052)View related products by pathway.
|
PTMs for PEAK1 Antibody (NBP1-91052)Learn more about PTMs related to PEAK1 Antibody (NBP1-91052).
| Research Areas for PEAK1 Antibody (NBP1-91052)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Rhodora Calizo 07/08/2016 |
||
Application: | WB | |
Species: | Mouse |
Verified Customer 06/27/2016 |
||
Application: | IF | |
Species: | Mouse |
Gene Symbol | PEAK1 |