PEAK1 Antibody

Images

 
Immunohistochemistry-Paraffin: PEAK1 Antibody [NBP1-91052] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEAK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EPNYESPSSNNQDKDSSQASKSSIKVPETHKAVLALRLEEKDGKIAVQTEKEESKASTDVAGQAVTINLVPTEEQAKPYRVVNLEQPLCK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEAK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PEAK1 Protein (NBP1-91052PEP)
Reviewed Applications
Read 2 Reviews rated 3.5
using
NBP1-91052 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEAK1 Antibody

  • FLJ21140
  • FLJ34483
  • KIAA2002
  • NKF3 kinase family member
  • pseudopodium enriched atypical kinase
  • pseudopodium-enriched atypical kinase 1
  • SGK269
  • sugen kinase 269
  • tyrosine-protein kinase SgK269

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91052
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for PEAK1 Antibody (NBP1-91052) (0)

There are no publications for PEAK1 Antibody (NBP1-91052).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEAK1 Antibody (NBP1-91052) (2) 3.52

Average Rating: 3.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.
We have 2 reviews tested in 2 application: WB, IF.

Reviews using NBP1-91052:
Filter by Applications
WB
(1)
IF
(1)
All Applications
Filter by Species
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot PEAK1 NBP1-91052
Enlarge
reviewed by:
Anonymous
WB Mouse 07/08/2016
View

Summary

ApplicationWestern Blot
Sample TestedKidney epithelial cells, whole cell lysates
SpeciesMouse
LotA96140

Blocking

Blocking Details4% BSA in TBST for 1.5 hour at room temperature

Primary Anitbody

Dilution Ratio1:500 PEAK1 Antibody in 4% BSA in TBST, overnight at 4 C

Secondary Antibody

Secondary DescriptionLicor Goat anti-rabbit IgG
Secondary Manufacturer Cat#926-32211
Secondary Concentration1:1000

Details

Detection NotesOdyssey Western blot detection, 700 HV
Immunofluorescence PEAK1 NBP1-91052
Enlarge
reviewed by:
Rhodora Calizo
IF Mouse 06/27/2016
View

Summary

ApplicationImmunofluorescence
Sample TestedMouse kidney epithelial cells
SpeciesMouse
LotA96140

Blocking

Blocking Details4% BSA in PBS for 1 hour at room temperature.

Primary Anitbody

Dilution Ratio1:50 PEAK1 Antibody in 4% BSA PBST. Incubated at 4 C overnight.

Secondary Antibody

Secondary Descriptiongoat-anti rabbit IgG

Details

Detection NotesConfocal microscopy. Negative control - secondary antibody stain, without primary antibody, was used.
Fixation DetailsCells were fixed with 4% PFA and permeabilized with 0.1% Triton X-100. Washing was done with PBS.
Wash DescriptionPBS was used as washing buffer. Washing was 10 minutes each/3x after primary and secondary antibody staining.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PEAK1 Antibody (NBP1-91052) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEAK1 Products

Bioinformatics Tool for PEAK1 Antibody (NBP1-91052)

Discover related pathways, diseases and genes to PEAK1 Antibody (NBP1-91052). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEAK1 Antibody (NBP1-91052)

Discover more about diseases related to PEAK1 Antibody (NBP1-91052).
 

Pathways for PEAK1 Antibody (NBP1-91052)

View related products by pathway.

PTMs for PEAK1 Antibody (NBP1-91052)

Learn more about PTMs related to PEAK1 Antibody (NBP1-91052).
 

Research Areas for PEAK1 Antibody (NBP1-91052)

Find related products by research area.

Blogs on PEAK1

There are no specific blogs for PEAK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3.5
5
0
4
1
3
1
2
0
1
0

Anonymous
07/08/2016
Application: WB
Species: Mouse

Rhodora Calizo
06/27/2016
Application: IF
Species: Mouse

Bioinformatics

Gene Symbol PEAK1