PDK-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PDPK1 Antibody [NBP2-56546] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDK-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHP
Specificity
Specificity of human PDPK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDPK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDK-1 Recombinant Protein Antigen (NBP2-56546PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PDK-1 Antibody

  • 3-phosphoinositide-dependent protein kinase 1
  • 3-phosphoinositide-dependent protein kinase 2 pseudogene
  • PDK1
  • PDK-1
  • PDPK1
  • PDPK2
  • PDPK2P
  • PkB kinase like gene 1
  • PKB kinase

Background

PDK-1 (3-phosphoinositide-dependent protein kinase, gene name PDPK1) is a 58 -68 kDa, 556 amino acid (aa) monomeric protein of the AGC serine/threonine kinase family. It is activated by phosphorylation in the presence of PtdIns(3,4,5) P3 or PtdIns(3,4) P2. Akt, S6 kinases, PKA and PKC-zeta are reported PDK-1 substrates. Through Akt, PDK-1 mediates many of the intracellular actions of insulin. Within the region used as an immunogen, human PDK-1 shares 98% aa identity with mouse and rat PDK-1. One reported isoform has an alternate start site at aa 50, while another lacking aa 238-263 is predicted to be catalytically inactive.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-88937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
NB600-1049
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67561
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-80423
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD

Publications for PDK-1 Antibody (NBP2-56546) (0)

There are no publications for PDK-1 Antibody (NBP2-56546).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDK-1 Antibody (NBP2-56546) (0)

There are no reviews for PDK-1 Antibody (NBP2-56546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PDK-1 Antibody (NBP2-56546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PDK-1 Products

Bioinformatics Tool for PDK-1 Antibody (NBP2-56546)

Discover related pathways, diseases and genes to PDK-1 Antibody (NBP2-56546). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDK-1 Antibody (NBP2-56546)

Discover more about diseases related to PDK-1 Antibody (NBP2-56546).
 

Pathways for PDK-1 Antibody (NBP2-56546)

View related products by pathway.

PTMs for PDK-1 Antibody (NBP2-56546)

Learn more about PTMs related to PDK-1 Antibody (NBP2-56546).
 

Research Areas for PDK-1 Antibody (NBP2-56546)

Find related products by research area.

Blogs on PDK-1

There are no specific blogs for PDK-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDK-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDPK1