Home » PDIK1L » PDIK1L Research Products » PDIK1L Antibody (4B7)

PDIK1L Antibody (4B7)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: PDIK1L Antibody (4B7) [H00149420-M01] - Detection limit for recombinant GST tagged PDIK1L is 0.3 ng/ml as a capture antibody.
Sandwich ELISA: PDIK1L Antibody (4B7) [H00149420-M01] - Detection limit for recombinant GST tagged PDIK1L is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
4B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PDIK1L Antibody (4B7) Summary

Immunogen
PDIK1L (NP_690048, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSIKSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVET
Specificity
PDIK1L (4B7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDIK1L
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDIK1L Antibody (4B7)

  • casein kinase
  • CLIK1LRP11-96L14.4
  • EC 2.7.11.1
  • PDLIM1 interacting kinase 1 like
  • PDLIM1-interacting kinase 1-like
  • serine/threonine-protein kinase PDIK1L
  • STK35L2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Choline kinase
alpha Antibody
NBP1-85630
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cervix shows moderate to strong positivity in mucus in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Casein Kinase 2
beta Antibody (2F12F3 ...
NBP2-52449
ELISA: Casein Kinase 2 beta Antibody (2F12F3) [NBP2-52449] - Black line: Control Antigen (100 ng); Purple line: Antigen(10ng); Blue line: Antigen (50 ng); Red line: Antigen (100 ng).
Western Blot: Casein Kinase 2 beta Antibody (2F12F3) [NBP2-52449] - Analysis using CSNK2B mouse mAb against Hela (1), Jurkat (2), K562 (3), HepG2 (4), C6 (5), SK-N-SH (6), NTERA-2 (7), MCF-7 (8), NIH/3T3 (9) cell lysate.
Flow Cytometry: Casein Kinase 2 beta Antibody (2F12F3) [NBP2-52449] - Flow cytometric analysis of Hela cells using CSNK2B mouse mAb (green) and negative control (red).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Choline Kinase
beta [Unconjugated]
8184-CK
Choline Kinase beta [Unconjugated]
Species: Hu
Applications: EnzAct
Casein Kinase 2
alpha Antibody (84472 ...
MAB7957
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.5 mg/mL. A specific band was detected for Casein Kinase 2 alpha at approximately 50-52 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human Casein Kinase 2 alpha Monoclonal Antibody (Catalog # MAB7957) . This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line,MOLT‑4 human acute lymphoblastic leukemia cell line, NIH‑3T3 mouse embryonic fibroblast cell line, C6 rat glioma cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Casein Kinase 2 alpha Monoclonal Antibody (Catalog # MAB7957) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Casein Kinase 2 alpha at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Casein Kinase 2 alpha was detected in immersion fixed HEK293 human embryonic kidney cell line using Mouse Anti-Human Casein Kinase 2 alpha Monoclonal Antibody (Catalog # MAB7957) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Cytokeratin, pan
Antibody (AE-1/AE-3)
NBP2-29429
Dual RNAscope ISH-IHC: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - FFPE tissue sections of human metastatic tonsil were probed for Pan Cytokeratin mRNA (ACD RNAScope probe, catalog # 310221; Fast Red chromogen, ACD catalog # 322500). Adjacent tissue section was processes for IHC using mouse monoclonal antibody (Novus catalog # NBP2-29429) at 0.3 ug/mL for 1 hour at room temperature followed by incubation with the anti-mouse IgG VisUCyte HRP Polymer Antibody (Novus Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue).
CyTOF-reported: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - Human fibroblasts. Blue: fibroblasts. Red: fibroblast + cytokeratin transfection. CyTOF image submitted by a verified customer review.
Flow Cytometry: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - Human Pan-Cytokeratins on HeLa Cells. Black: Cells alone; Green: Isotype Control; Red: PE-labeled Pan-Cytokeratin Monoclonal Antibody (AE-1/AE-3)
(37 Publications)
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
Casein Kinase 1
alpha Antibody
NBP2-50030
Western Blot: Casein Kinase 1 alpha Antibody [NBP2-50030] - Analysis of whole rat spinal cord homogenate stained with NBP2-50030, at dilution of 1:10,000. A prominent band running with an apparent SDS-PAGE molecular weight of ~38kDa and a less prominent band at ~34kDa corresponds to other Casein Kinase 1 alpha isotypes.
Immunocytochemistry/Immunofluorescence: Casein Kinase 1 alpha Antibody [NBP2-50030] - HeLa cells stained with NBP2-50030 (red) and panspecific mouse monoclonal antibody to nuclear pore complexes NBP1-05390 (green). Casein Kinase 1 alpha has a particulate distribution both in the nucleus and the cytoplasm. Blue is the Hoechst DNA stain.
Species: Bv, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
CSNK1A1L Antibody
NBP2-16020
Western Blot: CSNK1A1L Antibody [NBP2-16020] - CSNK1A1L Antibody detects CSNK1A1L protein by Western blot analysis. A. 50 ug rat thymus lysate/extract. 10 % SDS-PAGE. CSNK1A1L Antibody dilution: 1:500
Western Blot: CSNK1A1L Antibody [NBP2-16020] - Sample (30 ug of whole cell lysate) A: A549 10% SDS PAGE gel, diluted at 1:500.
Immunohistochemistry-Paraffin: CSNK1A1L Antibody [NBP2-16020] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:500 dilution.
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Calmodulin antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.A2058 melanoma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. C6 glioma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. HeLa Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
PER2 Antibody -
BSA Free
NB100-125
Western Blot: PER2 Antibody [NB100-125] - Western Blot Usage of NB100-125. Image submitted via verified customer review.
Immunocytochemistry/Immunofluorescence: PER2 Antibody [NB100-125] - MCF7 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PER2 Antibody at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: PER2 Antibody [NB100-125] - U-87 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PER2 Antibody at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/Immunofluorescence: APC Antibody [NB100-91662] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-APC Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: APC Antibody [NB100-91662] - An intracellular stain was performed on HeLa cells with APC Antibody NB100-91662AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunohistochemistry-Paraffin: APC Antibody [NB100-91662] - Paraffin-embedded human colon carcinoma tissue.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(14 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Axin-1 Antibody
AF3287
Western blot shows lysates of Raji human Burkitt's lymphoma cell line, Balb/3T3 mouse embryonic fibroblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Human/Mouse/Rat Axin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3287) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Axin-1 at approximately 120 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB
PDIK1L Antibody
(4B7)
H00149420-M01
PDIK1L Antibody (4B7)
Species: Hu
Applications: ELISA, S-ELISA

Publications for PDIK1L Antibody (H00149420-M01) (0)

There are no publications for PDIK1L Antibody (H00149420-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDIK1L Antibody (H00149420-M01) (0)

There are no reviews for PDIK1L Antibody (H00149420-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PDIK1L Antibody (H00149420-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDIK1L Products

Array H00149420-M01

Bioinformatics Tool for PDIK1L Antibody (H00149420-M01)

Discover related pathways, diseases and genes to PDIK1L Antibody (H00149420-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDIK1L Antibody (H00149420-M01)

Discover more about diseases related to PDIK1L Antibody (H00149420-M01).
 

Pathways for PDIK1L Antibody (H00149420-M01)

View related products by pathway.

Blogs on PDIK1L

There are no specific blogs for PDIK1L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDIK1L Antibody (4B7) and receive a gift card or discount.


Bioinformatics

Gene Symbol PDIK1L
Entrez
Uniprot