PDE5A Antibody [Allophycocyanin]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Allophycocyanin

PDE5A Antibody [Allophycocyanin] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human PDE5A (NP_001074.2).
  
  Sequence:
  MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDE5A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for PDE5A Antibody [Allophycocyanin]

• CGB-PDE
• cGMP-binding cGMP-specific 3'-5'-cyclic nucleotide phosphodiesterase
• cGMP-binding cGMP-specific phosphodiesterase
• cGMP-specific 3'-5'-cyclic phosphodiesterase
• cGMP-specific phosphodiesterase type 5A
• CN5A
• EC 3.1.4
• EC 3.1.4.35
• PDE5
• PDE5A
• phosphodiesterase 5A, cGMP-specific
• phosphodiesterase isozyme 5

Background

PDE5A encodes a cGMP-binding, cGMP-specific phosphodiesterase, a member of the cyclic nucleotide phosphodiesterase family. This phosphodiesterase specifically hydrolyzes cGMP to 5'-GMP. It is involved in the regulation of intracellular concentrations of cyclic nucleotides and is important for smooth muscle relaxation in the cardiovascular system. Alternative splicing of this gene results in three transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDE5A