PDE4C Antibody (4E5.)

Images

 
Immunocytochemistry/ Immunofluorescence: PDE4C Antibody (4E5) [H00005143-M02] - Analysis of monoclonal antibody to PDE4C on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: PDE4C Antibody (4E5) [H00005143-M02] - Detection limit for recombinant GST tagged PDE4C is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4E5.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PDE4C Antibody (4E5.) Summary

Immunogen
PDE4C (NP_000914, 1 a.a. - 99 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQS
Specificity
PDE4C - phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) (4E5)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDE4C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDE4C Antibody (4E5.)

  • cAMP-specific 3'-5'-cyclic phosphodiesterase 4C
  • DPDE1dunce
  • Drosophila)
  • EC 3.1.4
  • EC 3.1.4.17
  • MGC126222
  • PDE21
  • phosphodiesterase 4C, cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E1)
  • phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog
  • phosphodiesterase 4C, cAMP-specific
  • phosphodiesterase E1 dunce homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NBP1-83275
Species: Hu
Applications: IHC, IHC-P
NB300-672
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37404
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-46355
Species: Hu
Applications: WB, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03598
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005143-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PDE4C Antibody (H00005143-M02) (0)

There are no publications for PDE4C Antibody (H00005143-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE4C Antibody (H00005143-M02) (0)

There are no reviews for PDE4C Antibody (H00005143-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDE4C Antibody (H00005143-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE4C Products

Bioinformatics Tool for PDE4C Antibody (H00005143-M02)

Discover related pathways, diseases and genes to PDE4C Antibody (H00005143-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE4C Antibody (H00005143-M02)

Discover more about diseases related to PDE4C Antibody (H00005143-M02).
 

Pathways for PDE4C Antibody (H00005143-M02)

View related products by pathway.

PTMs for PDE4C Antibody (H00005143-M02)

Learn more about PTMs related to PDE4C Antibody (H00005143-M02).
 

Research Areas for PDE4C Antibody (H00005143-M02)

Find related products by research area.

Blogs on PDE4C

There are no specific blogs for PDE4C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE4C Antibody (4E5.) and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE4C
Entrez
Uniprot