PDE4B Antibody

Images

 
Immunohistochemistry-Paraffin: PDE4B Antibody [NBP1-84057] - Staining of human epididymis shows strong cytoplasmic positivity with granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDE4B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot reactivity reported in (PMID:25775568).
Control Peptide
PDE4B Protein (NBP1-84057PEP)
Publications
Read Publication using NBP1-84057.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25775568)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDE4B Antibody

  • cAMP-specific (phosphodiesterase E4 dunce homolog
  • cAMP-specific 3'-5'-cyclic phosphodiesterase 4B
  • cAMP-specific phosphodiesterase-4 B isoform
  • DKFZp686F2182
  • Drosophila)
  • dunce-like phosphodiesterase E4
  • EC 3.1.4
  • EC 3.1.4.17
  • MGC126529
  • PDE32
  • PDEIVB
  • phosphodiesterase 4B, cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E4)
  • phosphodiesterase 4B, cAMP-specific (dunce
  • phosphodiesterase 4B, cAMP-specific
  • phosphodiesterase E4 dunce homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32341
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NBP1-85645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83275
Species: Hu
Applications: IHC, IHC-P
NBP2-01086
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37404
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, CyTOF-ready

Publications for PDE4B Antibody (NBP1-84057)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for PDE4B Antibody (NBP1-84057) (0)

There are no reviews for PDE4B Antibody (NBP1-84057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE4B Antibody (NBP1-84057) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE4B Products

Bioinformatics Tool for PDE4B Antibody (NBP1-84057)

Discover related pathways, diseases and genes to PDE4B Antibody (NBP1-84057). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE4B Antibody (NBP1-84057)

Discover more about diseases related to PDE4B Antibody (NBP1-84057).
 

Pathways for PDE4B Antibody (NBP1-84057)

View related products by pathway.

PTMs for PDE4B Antibody (NBP1-84057)

Learn more about PTMs related to PDE4B Antibody (NBP1-84057).

Blogs on PDE4B

There are no specific blogs for PDE4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE4B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE4B