PDE1B Recombinant Protein Antigen

Images

 
There are currently no images for PDE1B Protein (NBP1-80934PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PDE1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE1B.

Source: E. coli

Amino Acid Sequence: TFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDE1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80934.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDE1B Recombinant Protein Antigen

  • 63 kDa Cam-PDE
  • calcium/calmodulin-dependent 3'-5'-cyclic nucleotide phosphodiesterase 1B
  • Cam-PDE 1B
  • EC 3.1.4
  • EC 3.1.4.17
  • PDE1B
  • PDE1B1calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase
  • PDES1B
  • PDES1Bcalmodulin-stimulated phosphodiesterase PDE1B1
  • phosphodiesterase 1B, calmodulin-dependent
  • phosphodiesterase IB, calmodulin-dependent
  • Phosphodiesterase-1B
  • presumed 63kDa form of the type 1 cyclic nucleotide phosphodiesterase familyknown as PDE1B

Background

PDE1B, a variant of PDE1, is a Ca2+-calmodulin-stimulated phosphodieterase (PDE) preferentially hydrolyzing cGMP. Cyclic nucleotides are hydrolyzed and compartmentalized by a family of enzymes called phosphodieterases. In mammals at least 11 different families of PDEs can be discriminated (PDE1-11) based on their kinetic properties and inhibition to various pharmacological agents. Three different PDE1 genes have been identified (PDE1A, PDE1B, PDE1C). The enzymes of the PDE1A and PDE1B have higher affinity for cGMP than for cAMP, whereas PDE1C has high affinity for both cAMP and cGMP. Calcium-Calmodulin stimulates the activity of each of these enzymes several-fold. The tissue distribution of PDE1B is different from other PDE1 gene family members. In testis PDE1B is expressed uniformly through out the seminiferous epithelium and in the interstistium in contrast to PDE1A and PDE1C that is expressed in elongated to mature spermatids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15343
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46355
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-02559
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-12242
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NB300-672
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-92265
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01171
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-645
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB300-639
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP1-85645
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-59947
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB4230
Species: Mu, Rt
Applications: IHC, WB
6507-IL/CF
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
NBP3-12244
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
7954-GM/CF
Species: Hu
Applications: BA

Publications for PDE1B Protein (NBP1-80934PEP) (0)

There are no publications for PDE1B Protein (NBP1-80934PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE1B Protein (NBP1-80934PEP) (0)

There are no reviews for PDE1B Protein (NBP1-80934PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDE1B Protein (NBP1-80934PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDE1B Products

Research Areas for PDE1B Protein (NBP1-80934PEP)

Find related products by research area.

Blogs on PDE1B

There are no specific blogs for PDE1B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDE1B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE1B