PDE1B Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PDE1B Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE1B.

  Source: E. coli

  Amino Acid Sequence: TFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PDE1B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80934.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDE1B Recombinant Protein Antigen

• 63 kDa Cam-PDE
• calcium/calmodulin-dependent 3'-5'-cyclic nucleotide phosphodiesterase 1B
• Cam-PDE 1B
• EC 3.1.4
• EC 3.1.4.17
• PDE1B
• PDE1B1calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase
• PDES1B
• PDES1Bcalmodulin-stimulated phosphodiesterase PDE1B1
• phosphodiesterase 1B, calmodulin-dependent
• phosphodiesterase IB, calmodulin-dependent
• Phosphodiesterase-1B
• presumed 63kDa form of the type 1 cyclic nucleotide phosphodiesterase familyknown as PDE1B

Background

PDE1B, a variant of PDE1, is a Ca2+-calmodulin-stimulated phosphodieterase (PDE) preferentially hydrolyzing cGMP. Cyclic nucleotides are hydrolyzed and compartmentalized by a family of enzymes called phosphodieterases. In mammals at least 11 different families of PDEs can be discriminated (PDE1-11) based on their kinetic properties and inhibition to various pharmacological agents. Three different PDE1 genes have been identified (PDE1A, PDE1B, PDE1C). The enzymes of the PDE1A and PDE1B have higher affinity for cGMP than for cAMP, whereas PDE1C has high affinity for both cAMP and cGMP. Calcium-Calmodulin stimulates the activity of each of these enzymes several-fold. The tissue distribution of PDE1B is different from other PDE1 gene family members. In testis PDE1B is expressed uniformly through out the seminiferous epithelium and in the interstistium in contrast to PDE1A and PDE1C that is expressed in elongated to mature spermatids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PDE1B