PDE10A Antibody (4E1) - Azide and BSA Free

Sandwich ELISA: PDE10A Antibody (40) [H00010846-M02] - Detection limit for recombinant GST tagged PDE10A is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 4E1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PDE10A Antibody (4E1) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PDE10A Antibody (4E1) - Azide and BSA Free (H00010846-M02) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PDE10A (NP_006652, 242 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQ
• Specificity: PDE10A (40)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PDE10A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDE10A Antibody (4E1) - Azide and BSA Free

• cAMP and cAMP-inhibited cGMP 3'-5'-cyclic phosphodiesterase 10A
• dJ416F21.1 (phosphodiesterase 10A)
• EC 3.1.4
• EC 3.1.4.17
• EC 3.1.4.35
• FLJ11894
• FLJ25677
• HSPDE10A
• PDE10A
• phosphodiesterase 10A
• phosphodiesterase 10A1 (PDE10A1)

Background

Various cellular responses are regulated by the second messengers cAMP and cGMP. Phosphodiesterases, such as PDE10A, eliminate cAMP- and cGMP-mediated intracellular signaling by hydrolyzing the cyclic nucleotide to the corresponding nucleoside 5-prime monophosphate (Fujishige et al., 2000 [PubMed 10998054]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDE10A
• Entrez:
  • 10846(Human)