PCYT1A Antibody (7H8)

Images

 
Western Blot: PCYT1A Antibody (7H8) [H00005130-M03] - Analysis of PCYT1A expression in K-562 (Cat # L009V1).
Western Blot: PCYT1A Antibody (7H8) [H00005130-M03] - Analysis of PCYT1A expression in PC-12 (Cat # L012V1).
Western Blot: PCYT1A Antibody (7H8) [H00005130-M03] - Analysis of PCYT1A expression in transfected 293T cell line by PCYT1A monoclonal antibody (M03), clone 7H8. Lane 1: PCYT1A transfected lysatE (41.7 KDa). Lane 2: ...read more
Sandwich ELISA: PCYT1A Antibody (7H8) [H00005130-M03] - Detection limit for recombinant GST tagged PCYT1A is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
7H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCYT1A Antibody (7H8) Summary

Immunogen
PCYT1A (NP_005008, 2 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHS
Specificity
PCYT1A - phosphate cytidylyltransferase 1, choline, alpha
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCYT1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCYT1A Antibody (7H8)

  • CCT A
  • CCT-alpha
  • choline-phosphate cytidylyltransferase A
  • CT A
  • CT
  • CTA
  • CTP:phosphocholine cytidylyltransferase A
  • CTPCTphosphate cytidylyltransferase 1, choline, alpha isoform
  • EC 2.7.7
  • EC 2.7.7.15
  • PCYT1CCTA
  • phosphate cytidylyltransferase 1, choline, alpha
  • Phosphorylcholine transferase A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-35213
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005130-M03
Species: Hu, Rt
Applications: WB, ELISA

Publications for PCYT1A Antibody (H00005130-M03) (0)

There are no publications for PCYT1A Antibody (H00005130-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCYT1A Antibody (H00005130-M03) (0)

There are no reviews for PCYT1A Antibody (H00005130-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCYT1A Antibody (H00005130-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCYT1A Products

Bioinformatics Tool for PCYT1A Antibody (H00005130-M03)

Discover related pathways, diseases and genes to PCYT1A Antibody (H00005130-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCYT1A Antibody (H00005130-M03)

Discover more about diseases related to PCYT1A Antibody (H00005130-M03).
 

Pathways for PCYT1A Antibody (H00005130-M03)

View related products by pathway.

PTMs for PCYT1A Antibody (H00005130-M03)

Learn more about PTMs related to PCYT1A Antibody (H00005130-M03).

Blogs on PCYT1A

There are no specific blogs for PCYT1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCYT1A Antibody (7H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCYT1A
Entrez
OMIM
Uniprot