PCSK1N Antibody (1E9) - Azide and BSA Free

Western Blot: PCSK1N Antibody (1E9) [H00027344-M02] - Analysis of PCSK1N expression in transfected 293T cell line by PCSK1N monoclonal antibody (M02), clone 1E9.Lane 1: PCSK1N transfected lysate (Predicted MW: 27.4 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: PCSK1N Antibody (1E9) [H00027344-M02] - Analysis of monoclonal antibody to PCSK1N on HeLa cell . Antibody concentration 20 ug/ml.

Immunohistochemistry-Paraffin: PCSK1N Antibody (1E9) [H00027344-M02] - Analysis of monoclonal antibody to PCSK1N on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml.

ELISA: PCSK1N Antibody (1E9) [H00027344-M02] - Detection limit for recombinant GST tagged PCSK1N is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1E9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PCSK1N Antibody (1E9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PCSK1N Antibody (1E9) - Azide and BSA Free (H00027344-M02) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-PCSK1N Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PCSK1N (NP_037403.1, 173 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP
• Specificity: PCSK1N - proprotein convertase subtilisin/kexin type 1 inhibitor (1E9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PCSK1N
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCSK1N Antibody (1E9) - Azide and BSA Free

• granin-like neuroendocrine peptide
• Proprotein convertase 1 inhibitor
• proprotein convertase subtilisin/kexin type 1 inhibitorPROSAAS
• proSAAS
• pro-SAAS
• SAAS

Background

Members of the subtilisin-like proprotein convertase family process latent precursor proteins into their biologically active products. The protein encoded by this gene appears to function as an endogenous inhibitor of proprotein convertase subtilisin/kexin type 1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCSK1N Antibody (H00027344-M02)(1)

Publication using H00027344-M02

• Liu T, Zhao Y, Tang N et al. Pax6 Directly Down-Regulates Pcsk1n Expression Thereby Regulating PC1/3 Dependent Proinsulin Processing. PLoS One. 2012-10-09 [PMID: 23056534]

Bioinformatics

• Gene Symbol: PCSK1N
• Entrez:
  • 27344(Human)
• Uniprot:
  • NP_037403(Human)