PCBD2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PCBD2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PCBD2.
  
  

  Source: E. coli

  Amino Acid Sequence: AMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PCBD2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85281.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PCBD2 Recombinant Protein Antigen

• 4-alpha-hydroxy-tetrahydropterin dehydratase 2
• DCOH2DCOHMPHS2,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2
• DcoH-like protein DCoHm
• dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle
• dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1)
• Dimerization cofactor of hepatocyte nuclear factor 1 from muscle
• EC 4.2.1.96
• HNF-1-alpha dimerization cofactor
• PHS 2
• pterin-4 alpha-carbinolamine dehydratase 2
• pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2
• pterin-4-alpha-carbinolamine dehydratase 2

Background

PCBD2, also known as Pterin-4-alpha-carbinolamine dehydratase 2, is a 130 amino acid protein that is 14 kDa, involved in tetrahydrobiopterin biosynthesis preventing the formation of 7-pterins and accelerating the formation of quinonoid-BH2, also being known to regulate the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity. The protein is being studied for its involvement in hyperphenylalaninemia. The PCBD2 has also been shown to have interactions with DYRK1B, AATF, ASCC2, C1D, and CHAF1A in pathways such as phenylalanine degradation I (aerobic) pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PCBD2