PBXIP1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PBXIP1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PBXIP1
  
  

  Source: E.coli

  Amino Acid Sequence: PGVSANASKAWHQKSHFQNSREWSGKEKWWDGQRDRKAEHWKHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGSKKE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PBXIP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25042It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PBXIP1 Recombinant Protein Antigen

• Hematopoietic PBX-interacting protein
• HPIPpre-B-cell leukemia transcription factor interacting protein 1
• pre-B-cell leukemia homeobox interacting protein 1
• pre-B-cell leukemia transcription factor-interacting protein 1

Background

Hematopoietic PBX-interacting protein (HPIP) was identified in a yeast two-hybrid screen for factors that interact with PBX1, a homeodomain protein that regulates gene transcription during development and differentiation. Recently, HPIP has been reported to interact with estrogen receptor alpha (ERalpha) and estrogen receptor beta (ERbeta) and modulate ER target gene expression. Alternate names for HPIP include pre-b-cell leukemia transcription factor-interacting protein 1, hematopoietic PBX-interacting protein, and PBKIP1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PBXIP1