Recombinant Human PBXIP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PBXIP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 480-578 of Human PBXIP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DGQRDRKAEHWKHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGSKKEGKRQGPKEPPRKSGSFHSSGEKQKQPRWREGTKDSHDPLPSWAELL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PBXIP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PBXIP1 Protein

  • Hematopoietic PBX-interacting protein
  • HPIPpre-B-cell leukemia transcription factor interacting protein 1
  • pre-B-cell leukemia homeobox interacting protein 1
  • pre-B-cell leukemia transcription factor-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
H00005090-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
H00057326-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PBXIP1 Partial Recombinant Protein (H00057326-Q01) (0)

There are no publications for PBXIP1 Partial Recombinant Protein (H00057326-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBXIP1 Partial Recombinant Protein (H00057326-Q01) (0)

There are no reviews for PBXIP1 Partial Recombinant Protein (H00057326-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PBXIP1 Partial Recombinant Protein (H00057326-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PBXIP1 Products

Bioinformatics Tool for PBXIP1 Partial Recombinant Protein (H00057326-Q01)

Discover related pathways, diseases and genes to PBXIP1 Partial Recombinant Protein (H00057326-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBXIP1 Partial Recombinant Protein (H00057326-Q01)

Discover more about diseases related to PBXIP1 Partial Recombinant Protein (H00057326-Q01).
 

Pathways for PBXIP1 Partial Recombinant Protein (H00057326-Q01)

View related products by pathway.

PTMs for PBXIP1 Partial Recombinant Protein (H00057326-Q01)

Learn more about PTMs related to PBXIP1 Partial Recombinant Protein (H00057326-Q01).

Blogs on PBXIP1

There are no specific blogs for PBXIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PBXIP1 Antibody
NB100-81652

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PBXIP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PBXIP1