Pax3 Recombinant Protein Antigen

Images

 
There are currently no images for Pax3 Protein (NBP2-32381PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Pax3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAX3.

Source: E. coli

Amino Acid Sequence: PHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAX3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32381.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pax3 Recombinant Protein Antigen

  • CDHS
  • HUP2
  • HUP2MGC120384
  • MGC120381
  • MGC120382
  • MGC120383
  • MGC134778
  • paired box 3
  • paired box gene 3 (Waardenburg syndrome 1)
  • paired box homeotic gene 3
  • paired box protein Pax-3
  • paired domain gene 3
  • paired domain gene HuP2
  • Pax3
  • Waardenburg syndrome 1
  • WS1
  • WS3

Background

PAX3 is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These proteins play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1675
Species: Ch, Hu, Mu, Rt
Applications: ICC, IHC
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF5769
Species: Hu
Applications: IHC, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF2864
Species: Hu
Applications: ICC, IHC, WB
MAB66861
Species: Hu
Applications: ICC, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00001908-M01
Species: Hu
Applications: ELISA, IP, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP1-88995
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-55646
Species: Hu
Applications: ICC/IF

Publications for Pax3 Protein (NBP2-32381PEP) (0)

There are no publications for Pax3 Protein (NBP2-32381PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pax3 Protein (NBP2-32381PEP) (0)

There are no reviews for Pax3 Protein (NBP2-32381PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Pax3 Protein (NBP2-32381PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pax3 Products

Research Areas for Pax3 Protein (NBP2-32381PEP)

Find related products by research area.

Blogs on Pax3.

FOXO1/FKHR (fork head in Rhabdomyosarcoma)
FOXO1 belongs to the very large Forkhead family of transcription factors which contain a conserved distinct DNA-binding domain known as the Forkhead Box, or FOX. The Forkhead domain is a 100 amino acid long motif capable of binding and bending DNA,...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Pax3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX3