Recombinant Human Patched 2/PTCH2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Patched 2/PTCH2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 79-188 of Human Patched 2/PTCH2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ETNLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTARQEGENILTPEALGLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKLFPCVILTP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PTCH2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Patched 2/PTCH2 GST (N-Term) Protein

  • patched (Drosophila) homolog 2
  • Patched 2
  • patched homolog 2 (Drosophila)
  • patched homolog 2
  • protein patched homolog 2
  • ptc2
  • PTCH2

Background

This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. This gene functions as a tumor suppressor. Mutations of this gene have been associated with nevoid basal cell carcinoma syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
464-SH/CF
Species: Mu
Applications: BA
AF482
Species: Mu
Applications: IHC, WB
NBP3-18136
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP2-35175
Species: Mu
Applications: BA, PAGE
NLS2666
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
NBP3-04509
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1705
Species: Mu
Applications: IHC, WB
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF3635
Species: Mu
Applications: IHC, WB
NBP1-87384
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1568
Species: Mu
Applications: WB

Publications for Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01) (0)

There are no publications for Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01) (0)

There are no reviews for Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Patched 2/PTCH2 Products

Bioinformatics Tool for Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01)

Discover related pathways, diseases and genes to Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01)

Discover more about diseases related to Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01).
 

Pathways for Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01)

View related products by pathway.

PTMs for Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01)

Learn more about PTMs related to Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01).
 

Research Areas for Patched 2/PTCH2 Partial Recombinant Protein (H00008643-Q01)

Find related products by research area.

Blogs on Patched 2/PTCH2

There are no specific blogs for Patched 2/PTCH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Patched 2/PTCH2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTCH2