Recombinant Human PAGE4 Protein

Images

 
SDS-Page: Recombinant Human PAGE4 Protein [H00009506-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human PAGE4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-102 of Human PAGE4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PAGE4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PAGE4 Protein

  • CT16.7
  • G antigen family C member 1
  • G antigen, family C, 1
  • GAGEC1GAGE-9
  • JM-27
  • P antigen family, member 4 (prostate associated)
  • PAGE-1
  • PAGE-4FLJ35184
  • Prostate-associated gene 4 protein
  • prostate-associated gene protein 4

Background

This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85414
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00003641-P01
Species: Hu
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-62688
Species: Hu
Applications: IHC, IHC-P
AF3134
Species: Hu
Applications: WB, Neut
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-84366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009506-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for PAGE4 Recombinant Protein (H00009506-P01) (0)

There are no publications for PAGE4 Recombinant Protein (H00009506-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAGE4 Recombinant Protein (H00009506-P01) (0)

There are no reviews for PAGE4 Recombinant Protein (H00009506-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAGE4 Recombinant Protein (H00009506-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PAGE4 Recombinant Protein (H00009506-P01)

Discover related pathways, diseases and genes to PAGE4 Recombinant Protein (H00009506-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAGE4 Recombinant Protein (H00009506-P01)

Discover more about diseases related to PAGE4 Recombinant Protein (H00009506-P01).
 

Pathways for PAGE4 Recombinant Protein (H00009506-P01)

View related products by pathway.

PTMs for PAGE4 Recombinant Protein (H00009506-P01)

Learn more about PTMs related to PAGE4 Recombinant Protein (H00009506-P01).
 

Research Areas for PAGE4 Recombinant Protein (H00009506-P01)

Find related products by research area.

Blogs on PAGE4

There are no specific blogs for PAGE4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
PAGE4 Antibody
NBP1-85413
SCP1 Antibody
NB300-229

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PAGE4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAGE4