PADI6 Antibody - BSA Free

Western Blot: PADI6 Antibody [NBP2-84208] - Host: Rabbit. Target Name: PADI6. Sample Tissue: Human A172 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

PADI6 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PADI6. Peptide sequence: SCILKKYRLVLHTSKEESKKARVYWPQKDNSSTFELVLGPDQHAYTLALL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PADI6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PADI6 Antibody - BSA Free

• protein-arginine deiminase type-6
• hPADVI
• peptidyl arginine deiminase, type VI

Background

Peptidylarginine deiminases (PADs, EC 3.5.3.15), including PADI6, make up a family of posttranslational proteinmodification enzymes that convert arginine residues to citrulline residues in the presence of calcium ions.(suppliedby OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PADI6