PACRG Recombinant Protein Antigen

Images

 
There are currently no images for PACRG Recombinant Protein Antigen (NBP2-55838PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PACRG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PACRG.

Source: E. coli

Amino Acid Sequence: AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PACRG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55838.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PACRG Recombinant Protein Antigen

  • FLJ32724
  • Glup
  • HAK005771
  • Molecular chaperone/chaperonin-binding protein
  • PARK2 coregulated gene protein
  • PARK2 co-regulated
  • PARK2CRG
  • parkin coregulated gene protein
  • parkin co-regulated gene protein
  • RP3-495O10.2

Background

PACRG (also known as Parkin coregulated gene protein and PARK2 coregulated) is a gene located very close to parkin, in reverse orientation on the chromosome. It is thought to be co-transcribed with parkin by a bi-directional promoter between the two genes. PACRG is expressed in all immune tissues, spleen, lymph nodes, thymus, tonsils, leukocyte and bone marrow and is also expressed in heart, brain, skeletal muscle, kidney, lung and pancreas. PACRG is expressed in primary Schwann cells and very weakly by monocyte-derived macrophages, which are the primary host cells of Mycobacterium leprae, the causative agent of leprosy. Splice variants have been described for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15255
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
211-TBB/CF
Species: Hu
Applications: BA
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-38234
Species: Hu
Applications: IHC,  IHC-P
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB
AF5049
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-87989
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89910
Species: Hu, Ze
Applications: ICC/IF, IHC,  IHC-P

Publications for PACRG Recombinant Protein Antigen (NBP2-55838PEP) (0)

There are no publications for PACRG Recombinant Protein Antigen (NBP2-55838PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PACRG Recombinant Protein Antigen (NBP2-55838PEP) (0)

There are no reviews for PACRG Recombinant Protein Antigen (NBP2-55838PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PACRG Recombinant Protein Antigen (NBP2-55838PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PACRG Products

Research Areas for PACRG Recombinant Protein Antigen (NBP2-55838PEP)

Find related products by research area.

Blogs on PACRG

There are no specific blogs for PACRG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PACRG Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PACRG