p73 Recombinant Protein Antigen

Images

 
There are currently no images for p73 Recombinant Protein Antigen (NBP2-58523PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

p73 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to p73.

Source: E. coli

Amino Acid Sequence: ATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TP73
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58523 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for p73 Recombinant Protein Antigen

  • p53-related protein
  • P73p53-like transcription factor
  • TA p73
  • TAp73
  • tumor protein p73

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-85571
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-18885
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo, CyTOF-ready, IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67899
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
MAB6798
Species: Hu
Applications: WB, ICC
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, KD
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-58523PEP
Species: Hu
Applications: AC

Publications for p73 Recombinant Protein Antigen (NBP2-58523PEP) (0)

There are no publications for p73 Recombinant Protein Antigen (NBP2-58523PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p73 Recombinant Protein Antigen (NBP2-58523PEP) (0)

There are no reviews for p73 Recombinant Protein Antigen (NBP2-58523PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p73 Recombinant Protein Antigen (NBP2-58523PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional p73 Products

Array NBP2-58523PEP

Bioinformatics Tool for p73 Recombinant Protein Antigen (NBP2-58523PEP)

Discover related pathways, diseases and genes to p73 Recombinant Protein Antigen (NBP2-58523PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p73 Recombinant Protein Antigen (NBP2-58523PEP)

Discover more about diseases related to p73 Recombinant Protein Antigen (NBP2-58523PEP).
 

Pathways for p73 Recombinant Protein Antigen (NBP2-58523PEP)

View related products by pathway.

PTMs for p73 Recombinant Protein Antigen (NBP2-58523PEP)

Learn more about PTMs related to p73 Recombinant Protein Antigen (NBP2-58523PEP).
 

Research Areas for p73 Recombinant Protein Antigen (NBP2-58523PEP)

Find related products by research area.

Blogs on p73.

p73: An Important Tumor Suppressor Cousin of p53
p73 has been identified as a long-lost cousin of the p53 tumor suppressor protein. It has high homology with both p53 and with p63, a gene implicated in the maintenance of epithelial stem cells. The presence of significant homology between the DNA-bin...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p73 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TP73