p38 beta/MAPK11 Antibody - BSA Free

Staining of human cell line MCF-7 shows localization to cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p38 beta/MAPK11 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein p38 beta/MAPK11 using the following amino acid sequence: EDEPEAEPYDESVEAKERTLEEWKELTYQEVL
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAPK11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for p38 beta/MAPK11 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.24
• MAP kinase 11
• MAP kinase p38 beta
• MAPK 11
• MAPK11
• mitogen-activated protein kinase 11
• Mitogen-activated protein kinase p38 beta
• mitogen-activated protein kinase p38-2
• MPK11
• p38 beta
• p38b
• p38beta
• P38BETA2
• PRKM11
• SAPK2B
• SAPK2p38-2P38B
• Stress-activated protein kinase 2
• stress-activated protein kinase-2
• stress-activated protein kinase-2b

Background

MAPK11 is encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAPK11