P2Y6/P2RY6 Antibody (4I8C9) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 229-328 of human P2Y6/P2RY6 (Q15077). VAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
P2RY6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for P2Y6/P2RY6 Antibody (4I8C9)
Background
The purinergic receptor P2Y6 (P2RY6) is a member of the Purinergic Receptor subfamily. P2 receptors mediate a wide variety of physiologic effects in response to extracellular nucleotides. P2Y6 is believed to play a role in placental function and innate immune defense. P2Y6 expression has been documented in various blood cells, bone marrow, brain, colon, heart, kidney, ovary, placenta, spleen,and thymus. ESTs have been isolated from cervix, embryo, eye, kidney, liver/spleen, placenta, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA
Publications for P2Y6/P2RY6 Antibody (NBP3-16259) (0)
There are no publications for P2Y6/P2RY6 Antibody (NBP3-16259).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for P2Y6/P2RY6 Antibody (NBP3-16259) (0)
There are no reviews for P2Y6/P2RY6 Antibody (NBP3-16259).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for P2Y6/P2RY6 Antibody (NBP3-16259) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional P2Y6/P2RY6 Products
Research Areas for P2Y6/P2RY6 Antibody (NBP3-16259)
Find related products by research area.
|
Blogs on P2Y6/P2RY6