P2Y14/GPR105 Antibody - BSA Free

Western Blot: P2Y14/GPR105 Antibody [NBP2-86744] - WB Suggested Anti-P2RY14 Antibody. Titration: 1.0 ug/ml. Positive Control: MDA-MB-435S Whole CellP2RY14 is supported by BioGPS gene expression data to be expressed in MDA-MB435

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

P2Y14/GPR105 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit P2Y14/GPR105 Antibody - BSA Free (NBP2-86744) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human P2Y14/GPR105. Peptide sequence: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P2RY14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for P2Y14/GPR105 Antibody - BSA Free

• G protein coupled receptor for UDP-glucose
• GPR105
• G-protein coupled receptor 105
• KIAA0001G protein-coupled receptor 105
• P2RY14
• P2Y purinoceptor 14
• P2Y(14) receptor
• P2Y14 receptor
• P2Y14
• purinergic receptor P2Y, G-protein coupled, 14
• UDP-glucose receptor

Background

GPR105 is a Sugar-Sensing Receptor. GPR105 is a G-protein-coupled receptor identifying a quiescent, primitive population of hematopoietic cells restricted to bone marrow. GPC105 has been suggested to mediates primitive cell responses to specific hematopoietic microenvironments and extends the known immune system functions of P2Y receptors to the stem cell level. GPR105 has also been suggested to play an important role in peripheral and neuroimmune function in response to extracellular UDP-sugars. GPR105 has been reported to be expressed in brain. ESTs have been isolated from kidney, placenta, uterus, and heart/melanocyte/uterus libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: P2RY14