P2X7/P2RX7 Antibody


Western Blot: P2X7/P2RX7 Antibody [NBP1-82738] - Analysis in human cell lines SK-MEL-30 and Caco-2 using anti-P2RX7 antibody. Corresponding P2RX7 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: P2X7/P2RX7 Antibody [NBP1-82738] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Western Blot: P2X7/P2RX7 Antibody [NBP1-82738] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

P2X7/P2RX7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSR
Specificity of human P2X7/P2RX7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
P2X7/P2RX7 Recombinant Protein Antigen (NBP1-82738PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for P2X7/P2RX7 Antibody

  • ATP receptor
  • MGC20089
  • P2RX7
  • P2X purinoceptor 7
  • P2X7
  • P2X7P2X7 receptor
  • P2X7R
  • P2Z receptor
  • purinergic receptor P2X, ligand-gated ion channel, 7
  • purinergic receptor P2X7 variant A
  • Purinergic receptor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for P2X7/P2RX7 Antibody (NBP1-82738) (0)

There are no publications for P2X7/P2RX7 Antibody (NBP1-82738).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2X7/P2RX7 Antibody (NBP1-82738) (0)

There are no reviews for P2X7/P2RX7 Antibody (NBP1-82738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2X7/P2RX7 Antibody (NBP1-82738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional P2X7/P2RX7 Products

Bioinformatics Tool for P2X7/P2RX7 Antibody (NBP1-82738)

Discover related pathways, diseases and genes to P2X7/P2RX7 Antibody (NBP1-82738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2X7/P2RX7 Antibody (NBP1-82738)

Discover more about diseases related to P2X7/P2RX7 Antibody (NBP1-82738).

Pathways for P2X7/P2RX7 Antibody (NBP1-82738)

View related products by pathway.

PTMs for P2X7/P2RX7 Antibody (NBP1-82738)

Learn more about PTMs related to P2X7/P2RX7 Antibody (NBP1-82738).

Blogs on P2X7/P2RX7

There are no specific blogs for P2X7/P2RX7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our P2X7/P2RX7 Antibody and receive a gift card or discount.


Gene Symbol P2RX7