We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human P2X3/P2RX3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related P2X3/P2RX3 Peptides and Proteins

Order Details


    • Catalog Number
      H00005024-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human P2X3/P2RX3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 45-154 of Human P2X3/P2RX3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HEKAYQVRDTAIESSVVTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
P2RX3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human P2X3/P2RX3 GST (N-Term) Protein

  • ATP receptor
  • MGC129956
  • P2RX3
  • P2X purinoceptor 3
  • P2X receptor, subunit 3
  • P2X3
  • P2X3purinergic receptor P2X3
  • purinergic receptor P2X, ligand-gated ion channel, 3
  • Purinergic receptor
  • purinoceptor P2X3

Background

P2RX3 - purinergic receptor P2X, ligand-gated ion channel, 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19655
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92239
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-37775
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP3-35187
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP1-30565
Species: Hu, Rt
Applications: IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
NBP3-48734
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-30741
Species: Gp, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-99485
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-78249
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
H00005024-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01) (0)

There are no publications for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01) (0)

There are no reviews for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in buying P2X3 PARTIAL RECOMBINANT PROTEIN (H00005024-Q01) from your company. In would like to know is this the same as a normal protein lysis? Can I just use like a normal protein to do Western blot? Some people told me, we have to transfect this protein in bacteria, and we have to elute the protein from that. Is this true? I want to use this p2x3 partial recombinant protein in immunoprecipitation experiments to see, if it is binding with my protein of interest. Is this possible? Because in your protocol, it shows this is not active protein.
    • This partial recombinant protein is mainly intended to be used as a positive control for WB and ELISA applications. This protein also has a 26 kDa N-term GST tag that could interfere with binding to your protein and to your column for IP. I would not recommend this product for your use, but if you have additional questions or concerns please contact our Technical Support Team.

Additional P2X3/P2RX3 Products

Research Areas for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01)

Find related products by research area.

Blogs on P2X3/P2RX3

There are no specific blogs for P2X3/P2RX3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human P2X3/P2RX3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RX3