Recombinant Human P2X3/P2RX3 GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 45-154 of Human P2X3/P2RX3 Source: Wheat Germ (in vitro) Amino Acid Sequence: HEKAYQVRDTAIESSVVTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCP |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
P2RX3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human P2X3/P2RX3 GST (N-Term) Protein
Background
P2RX3 - purinergic receptor P2X, ligand-gated ion channel, 3
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Rt
Applications: IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Gp, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01) (0)
There are no publications for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01) (0)
There are no reviews for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01). (Showing 1 - 1 of 1 FAQ).
-
I am interested in buying P2X3 PARTIAL RECOMBINANT PROTEIN (H00005024-Q01) from your company. In would like to know is this the same as a normal protein lysis? Can I just use like a normal protein to do Western blot? Some people told me, we have to transfect this protein in bacteria, and we have to elute the protein from that. Is this true? I want to use this p2x3 partial recombinant protein in immunoprecipitation experiments to see, if it is binding with my protein of interest. Is this possible? Because in your protocol, it shows this is not active protein.
- This partial recombinant protein is mainly intended to be used as a positive control for WB and ELISA applications. This protein also has a 26 kDa N-term GST tag that could interfere with binding to your protein and to your column for IP. I would not recommend this product for your use, but if you have additional questions or concerns please contact our Technical Support Team.
Additional P2X3/P2RX3 Products
Research Areas for P2X3/P2RX3 Partial Recombinant Protein (H00005024-Q01)
Find related products by research area.
|
Blogs on P2X3/P2RX3