p19 INK4d Antibody (2E10.)

Images

 
Western Blot: p19 INK4d Antibody (2E10) [H00001032-M08] - Analysis of CDKN2D expression in transfected 293T cell line by CDKN2D monoclonal antibody (M08), clone 2E10. Lane 1: CDKN2D transfected lysatE (17.7 KDa). Lane ...read more
Immunoprecipitation: p19 INK4d Antibody (2E10) [H00001032-M08] - Analysis of CDKN2D transfected lysate using anti-CDKN2D monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CDKN2D rabbit polyclonal ...read more
Sandwich ELISA: p19 INK4d Antibody (2E10) [H00001032-M08] - Detection limit for recombinant GST tagged CDKN2D is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

p19 INK4d Antibody (2E10.) Summary

Immunogen
CDKN2D (AAH01822, 1 a.a. - 166 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Specificity
CDKN2D - cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (2E10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDKN2D
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p19 INK4d Antibody (2E10.)

  • CDK inhibitor p19INK4d
  • cell cycle inhibitor, Nur77 associating protein
  • cyclin-dependent kinase 4 inhibitor D p19
  • cyclin-dependent kinase 4 inhibitor D
  • cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
  • inhibitor of cyclin-dependent kinase 4d
  • INK4D
  • p19
  • p19-INK4D

Background

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for p19 INK4d Antibody (H00001032-M08) (0)

There are no publications for p19 INK4d Antibody (H00001032-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p19 INK4d Antibody (H00001032-M08) (0)

There are no reviews for p19 INK4d Antibody (H00001032-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p19 INK4d Antibody (H00001032-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p19 INK4d Products

Bioinformatics Tool for p19 INK4d Antibody (H00001032-M08)

Discover related pathways, diseases and genes to p19 INK4d Antibody (H00001032-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p19 INK4d Antibody (H00001032-M08)

Discover more about diseases related to p19 INK4d Antibody (H00001032-M08).
 

Pathways for p19 INK4d Antibody (H00001032-M08)

View related products by pathway.

PTMs for p19 INK4d Antibody (H00001032-M08)

Learn more about PTMs related to p19 INK4d Antibody (H00001032-M08).
 

Research Areas for p19 INK4d Antibody (H00001032-M08)

Find related products by research area.

Blogs on p19 INK4d

There are no specific blogs for p19 INK4d, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p19 INK4d Antibody (2E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKN2D
Entrez
Uniprot